Viewing data for Anser albifrons


Scientific name Anser albifrons
Common name Greater white-fronted goose
Maximum lifespan 47.00 years (Anser albifrons@AnAge)

Total mtDNA (size: 16737 bases) GC AT G C A T
Base content (bases) 7904 8833 5364 2540 3787 5046
Base content per 1 kb (bases) 472 528 320 152 226 301
Base content (%) 47.2% 52.8%
Total protein-coding genes (size: 11385 bases) GC AT G C A T
Base content (bases) 5488 5897 3906 1582 2566 3331
Base content per 1 kb (bases) 482 518 343 139 225 293
Base content (%) 48.2% 51.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1538 bases) GC AT G C A T
Base content (bases) 653 885 388 265 377 508
Base content per 1 kb (bases) 425 575 252 172 245 330
Base content (%) 42.5% 57.5%
Total rRNA-coding genes (size: 2597 bases) GC AT G C A T
Base content (bases) 1207 1390 682 525 529 861
Base content per 1 kb (bases) 465 535 263 202 204 332
Base content (%) 46.5% 53.5%
12S rRNA gene (size: 988 bases) GC AT G C A T
Base content (bases) 476 512 275 201 195 317
Base content per 1 kb (bases) 482 518 278 203 197 321
Base content (%) 48.2% 51.8%
16S rRNA gene (size: 1609 bases) GC AT G C A T
Base content (bases) 731 878 407 324 334 544
Base content per 1 kb (bases) 454 546 253 201 208 338
Base content (%) 45.4% 54.6%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 320 364 255 65 162 202
Base content per 1 kb (bases) 468 532 373 95 237 295
Base content (%) 46.8% 53.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 78 90 66 12 34 56
Base content per 1 kb (bases) 464 536 393 71 202 333
Base content (%) 46.4% 53.6%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 756 795 497 259 378 417
Base content per 1 kb (bases) 487 513 320 167 244 269
Base content (%) 48.7% 51.3%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 336 351 224 112 156 195
Base content per 1 kb (bases) 489 511 326 163 227 284
Base content (%) 48.9% 51.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 395 389 267 128 175 214
Base content per 1 kb (bases) 504 496 341 163 223 273
Base content (%) 50.4% 49.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 561 582 402 159 262 320
Base content per 1 kb (bases) 491 509 352 139 229 280
Base content (%) 49.1% 50.9%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 460 518 315 145 247 271
Base content per 1 kb (bases) 470 530 322 148 253 277
Base content (%) 47.0% 53.0%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 490 551 366 124 233 318
Base content per 1 kb (bases) 471 529 352 119 224 305
Base content (%) 47.1% 52.9%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 179 173 121 58 87 86
Base content per 1 kb (bases) 509 491 344 165 247 244
Base content (%) 50.9% 49.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 641 737 477 164 320 417
Base content per 1 kb (bases) 465 535 346 119 232 303
Base content (%) 46.5% 53.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 148 149 99 49 74 75
Base content per 1 kb (bases) 498 502 333 165 249 253
Base content (%) 49.8% 50.2%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 860 958 614 246 390 568
Base content per 1 kb (bases) 473 527 338 135 215 312
Base content (%) 47.3% 52.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 269 253 206 63 52 201
Base content per 1 kb (bases) 515 485 395 121 100 385
Base content (%) 51.5% 48.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 58 (25.55%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 13 (5.73%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 18 9 7 15 29 0 6 7 1 0 4 3 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 10 5 0 1 4 1 1 2 7 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 1 3 7 1 0 0 4 1 2 1 1 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 3 0 0 3 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 85 72 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 66 37 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 104 93 22
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMVMTWLTLALLIQPKLLAFTTTNPPSNKTSLTTKPTPWSWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 2 0 4 3 0 1 1 1 1 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 0 4 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 2 0 0 2 2 0 0 0 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 21 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 26 9 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 22 26 5
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 40 (7.75%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 43 (8.33%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 33 21 4 14 35 6 4 7 3 5 13 14 2 16 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 8 26 10 1 4 14 22 7 3 15 10 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 13 2 1 11 10 2 0 3 2 15 0 0 0 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 9 1 3 12 8 1 0 1 7 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 126 135 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 232 187 67
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 15 (6.58%)
Serine (Ser, S)
n = 21 (9.21%)
Threonine (Thr, T)
n = 13 (5.7%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.89%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 7 (3.07%)
Proline (Pro, P)
n = 15 (6.58%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 5 2 10 11 3 3 7 0 5 3 8 2 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 3 9 3 0 0 3 3 3 2 5 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 1 0 8 8 2 0 3 1 7 1 1 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 12 2 1 12 4 0 0 2 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 63 50 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 61 62 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 100 83 28
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 14 7 1 9 13 7 1 5 1 1 7 6 0 3 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 0 14 7 1 0 6 11 2 1 3 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 9 1 1 5 7 1 1 4 0 9 0 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 7 1 2 3 3 1 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 71 60 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 127 100 16
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 34 (8.95%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 22 (5.79%)
Cysteine (Cys, C)
n = 5 (1.32%)
Valine (Val, V)
n = 18 (4.74%)
Leucine (Leu, L)
n = 65 (17.11%)
Isoleucine (Ile, I)
n = 32 (8.42%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 26 (6.84%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 18 (4.74%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 30 7 2 17 34 5 7 5 3 0 5 11 2 1 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 5 6 20 8 0 1 7 13 2 2 7 14 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 6 0 1 9 12 1 0 2 1 12 1 0 5 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 0 0 9 9 1 1 2 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 111 93 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 104 78 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 187 149 26
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 29 (8.92%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 60 (18.46%)
Isoleucine (Ile, I)
n = 20 (6.15%)
Methionine (Met, M)
n = 19 (5.85%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 20 (6.15%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 9 (2.77%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 14 14 4 10 38 6 2 5 1 4 7 5 1 7 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 3 16 10 2 1 5 5 3 5 10 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 11 0 6 5 9 1 0 8 3 12 1 0 1 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 1 3 7 0 0 1 5 2 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 99 82 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 95 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 121 135 43
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 38 (10.98%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 25 (7.23%)
Methionine (Met, M)
n = 19 (5.49%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.18%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 15 14 6 13 30 9 7 8 1 2 4 6 0 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 22 10 2 0 7 4 0 2 7 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 18 1 1 13 8 2 0 7 0 8 1 0 2 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 0 2 13 1 0 2 1 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 102 113 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 122 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 142 146 35
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 38 (10.98%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 25 (7.23%)
Methionine (Met, M)
n = 19 (5.49%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.18%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 15 14 6 13 30 9 7 8 1 2 4 6 0 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 22 10 2 0 7 4 0 2 7 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 18 1 1 13 8 2 0 7 0 8 1 0 2 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 0 2 13 1 0 2 1 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 102 113 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 122 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 142 146 35
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.59%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 46 (10.04%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 99 (21.62%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 27 (5.9%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 12 (2.62%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 32 21 3 17 54 16 8 12 2 1 4 5 0 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 3 16 12 0 2 8 8 3 1 12 14 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 16 3 4 13 13 1 0 8 2 12 2 1 1 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 0 0 2 9 1 1 2 8 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 157 143 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 136 75 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 184 199 40
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 4 1 2 10 3 2 2 0 0 1 4 0 0 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 0 5 0 2 0 4 1 1 0 1 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 5 4 2 0 3 0 1 0 0 0 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 28 23 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 26 17 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 45 35 7
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 59 (9.75%)
Serine (Ser, S)
n = 39 (6.45%)
Threonine (Thr, T)
n = 62 (10.25%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 23 (3.8%)
Leucine (Leu, L)
n = 99 (16.36%)
Isoleucine (Ile, I)
n = 49 (8.1%)
Methionine (Met, M)
n = 33 (5.45%)
Proline (Pro, P)
n = 32 (5.29%)
Phenylalanine (Phe, F)
n = 34 (5.62%)
Tyrosine (Tyr, Y)
n = 11 (1.82%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 7 (1.16%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 27 (4.46%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 41 30 5 23 53 14 3 18 1 1 6 13 3 10 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 6 8 35 15 1 1 6 22 4 1 14 16 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 21 1 5 10 12 3 1 8 0 11 2 1 5 22 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 5 2 5 21 2 0 3 6 0 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
135 170 204 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 183 115 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 261 249 55
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.18%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 32 (18.5%)
Leucine (Leu, L)
n = 22 (12.72%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 17 (9.83%)
Tyrosine (Tyr, Y)
n = 6 (3.47%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 3 (1.73%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 0 3 0 0 7 5 0 0 12 1 3 16 13 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 2 5 0 5 7 6 1 2 19 3 0 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 2 1 1 6 1 0 6 0 4 7 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 2 0 0 1 0 0 0 5 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 20 19 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 34 16 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
83 9 17 65
Total protein-coding genes (size: 11402 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 223 (5.87%)
Alanine (Ala, A)
n = 330 (8.69%)
Serine (Ser, S)
n = 283 (7.45%)
Threonine (Thr, T)
n = 305 (8.03%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 197 (5.19%)
Leucine (Leu, L)
n = 646 (17.0%)
Isoleucine (Ile, I)
n = 278 (7.32%)
Methionine (Met, M)
n = 180 (4.74%)
Proline (Pro, P)
n = 229 (6.03%)
Phenylalanine (Phe, F)
n = 229 (6.03%)
Tyrosine (Tyr, Y)
n = 107 (2.82%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 64 (1.68%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 125 (3.29%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 110 (2.9%)
Lysine (Lys, K)
n = 89 (2.34%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
61 217 136 40 145 320 78 52 81 14 32 57 80 28 66 163
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
44 4 25 42 182 90 16 16 66 94 47 22 88 109 10 39
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
141 115 10 25 90 92 21 3 52 16 91 13 11 22 103 15
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
95 73 19 11 53 80 9 2 17 44 8 1 2 5 3 94
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
906 1088 1035 771
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
488 1092 690 1530
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
333 1585 1466 416

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.