Viewing data for Bubulcus ibis


Scientific name Bubulcus ibis
Common name Cattle egret
Maximum lifespan 23.00 years (Bubulcus ibis@AnAge)

Total mtDNA (size: 18959 bases) GC AT G C A T
Base content (bases) 8335 10624 5760 2575 4670 5954
Base content per 1 kb (bases) 440 560 304 136 246 314
Base content (%) 44.0% 56.0%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 5189 6190 3828 1361 2730 3460
Base content per 1 kb (bases) 456 544 336 120 240 304
Base content (%) 45.6% 54.4%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1547 bases) GC AT G C A T
Base content (bases) 659 888 398 261 380 508
Base content per 1 kb (bases) 426 574 257 169 246 328
Base content (%) 42.6% 57.4%
Total rRNA-coding genes (size: 2559 bases) GC AT G C A T
Base content (bases) 1176 1383 687 489 538 845
Base content per 1 kb (bases) 460 540 268 191 210 330
Base content (%) 46.0% 54.0%
12S rRNA gene (size: 971 bases) GC AT G C A T
Base content (bases) 457 514 260 197 201 313
Base content per 1 kb (bases) 471 529 268 203 207 322
Base content (%) 47.1% 52.9%
16S rRNA gene (size: 1588 bases) GC AT G C A T
Base content (bases) 719 869 427 292 337 532
Base content per 1 kb (bases) 453 547 269 184 212 335
Base content (%) 45.3% 54.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 313 371 251 62 162 209
Base content per 1 kb (bases) 458 542 367 91 237 306
Base content (%) 45.8% 54.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 79 89 66 13 37 52
Base content per 1 kb (bases) 470 530 393 77 220 310
Base content (%) 47.0% 53.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 708 843 458 250 400 443
Base content per 1 kb (bases) 456 544 295 161 258 286
Base content (%) 45.6% 54.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 317 367 219 98 155 212
Base content per 1 kb (bases) 463 537 320 143 227 310
Base content (%) 46.3% 53.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 362 422 245 117 198 224
Base content per 1 kb (bases) 462 538 313 149 253 286
Base content (%) 46.2% 53.8%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 542 601 403 139 284 317
Base content per 1 kb (bases) 474 526 353 122 248 277
Base content (%) 47.4% 52.6%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 453 525 324 129 265 260
Base content per 1 kb (bases) 463 537 331 132 271 266
Base content (%) 46.3% 53.7%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 433 608 339 94 263 345
Base content per 1 kb (bases) 416 584 326 90 253 331
Base content (%) 41.6% 58.4%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 154 198 117 37 100 98
Base content per 1 kb (bases) 438 563 332 105 284 278
Base content (%) 43.8% 56.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 620 758 484 136 333 425
Base content per 1 kb (bases) 450 550 351 99 242 308
Base content (%) 45.0% 55.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 140 157 102 38 72 85
Base content per 1 kb (bases) 471 529 343 128 242 286
Base content (%) 47.1% 52.9%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 827 988 632 195 407 581
Base content per 1 kb (bases) 456 544 348 107 224 320
Base content (%) 45.6% 54.4%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 246 276 191 55 58 218
Base content per 1 kb (bases) 471 529 366 105 111 418
Base content (%) 47.1% 52.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 27 (11.89%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 63 (27.75%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 15 8 8 21 29 1 4 8 0 1 4 2 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 3 7 6 0 1 4 3 0 1 5 10 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 0 4 3 0 1 3 2 1 0 0 2 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 2 1 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 92 72 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 66 34 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 93 103 28
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFLILLMSWMTFSLIIQPKLLAFTTTNPPSTKSKASSKTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 2 1 3 2 0 1 1 1 0 0 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 2 0 0 0 0 0 1 3 3 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 0 0 0 4 1 1 0 0 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 2 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 16 22 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 25 10 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 25 20 5
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 42 (8.14%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (6.98%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 27 (5.23%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 24 25 3 13 33 4 8 7 2 3 13 19 1 14 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 7 25 14 0 9 14 21 3 3 4 21 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 17 1 2 12 10 0 1 2 7 11 2 0 2 12 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 1 5 10 9 0 0 1 7 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 119 134 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 142 94 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 197 215 86
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 15 9 3 8 15 3 1 7 0 3 7 5 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 6 7 0 1 3 4 0 3 5 5 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 0 3 6 7 0 0 4 1 7 0 1 1 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 2 4 8 4 0 1 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 65 56 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 59 60 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 95 96 29
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 13 7 4 10 14 0 5 7 1 4 4 4 1 3 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 3 6 13 0 4 4 9 2 2 6 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 13 1 2 6 6 0 0 6 4 6 1 0 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 1 1 3 4 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 70 59 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 107 110 36
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 25 (6.58%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 29 (7.63%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 17 (4.47%)
Leucine (Leu, L)
n = 68 (17.89%)
Isoleucine (Ile, I)
n = 29 (7.63%)
Methionine (Met, M)
n = 11 (2.89%)
Proline (Pro, P)
n = 26 (6.84%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 21 9 5 25 29 2 7 7 1 3 7 7 0 4 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 3 16 6 0 1 10 12 2 4 12 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 11 1 3 7 11 0 0 1 2 11 0 0 2 19 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 1 2 4 9 1 2 4 2 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 115 101 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 101 78 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 187 138 46
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 29 (8.92%)
Threonine (Thr, T)
n = 24 (7.38%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 13 (4.0%)
Leucine (Leu, L)
n = 63 (19.38%)
Isoleucine (Ile, I)
n = 25 (7.69%)
Methionine (Met, M)
n = 12 (3.69%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 19 (5.85%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 9 (2.77%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 11 (3.38%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 15 9 8 10 34 7 2 4 1 3 3 6 1 8 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 6 12 12 0 1 6 5 1 4 11 8 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 8 0 7 12 5 0 0 5 4 10 1 2 2 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 2 2 5 2 1 3 4 0 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 98 85 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 102 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 124 121 61
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 26 (7.51%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 49 (14.16%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 68 (19.65%)
Isoleucine (Ile, I)
n = 32 (9.25%)
Methionine (Met, M)
n = 16 (4.62%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 22 14 7 14 34 5 8 9 0 1 0 6 0 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 10 11 0 2 3 5 1 5 7 8 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 20 0 5 7 14 0 2 2 2 5 1 0 3 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 1 0 11 4 0 1 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 102 129 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 121 61 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 116 155 61
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 26 (7.51%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 49 (14.16%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 68 (19.65%)
Isoleucine (Ile, I)
n = 32 (9.25%)
Methionine (Met, M)
n = 16 (4.62%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 22 14 7 14 34 5 8 9 0 1 0 6 0 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 10 11 0 2 3 5 1 5 7 8 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 20 0 5 7 14 0 2 2 2 5 1 0 3 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 1 0 11 4 0 1 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 102 129 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 121 61 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 116 155 61
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.15%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 34 (7.42%)
Threonine (Thr, T)
n = 56 (12.23%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 8 (1.75%)
Leucine (Leu, L)
n = 100 (21.83%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 29 (6.33%)
Phenylalanine (Phe, F)
n = 14 (3.06%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 13 (2.84%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 16 (3.49%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 30 19 9 26 48 4 13 13 0 1 2 5 0 2 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 8 11 12 0 6 7 5 1 4 15 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 19 0 3 9 13 0 1 8 4 10 1 0 1 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 1 1 9 1 0 2 9 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 156 153 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 141 77 187
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 187 195 64
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 6 0 5 10 1 4 2 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 6 2 0 2 1 1 0 0 2 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 3 0 1 2 5 0 1 3 0 2 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 0 0 1 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 29 28 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 30 17 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 43 40 12
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.46%)
Alanine (Ala, A)
n = 48 (7.95%)
Serine (Ser, S)
n = 47 (7.78%)
Threonine (Thr, T)
n = 76 (12.58%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 10 (1.66%)
Leucine (Leu, L)
n = 105 (17.38%)
Isoleucine (Ile, I)
n = 50 (8.28%)
Methionine (Met, M)
n = 31 (5.13%)
Proline (Pro, P)
n = 30 (4.97%)
Phenylalanine (Phe, F)
n = 31 (5.13%)
Tyrosine (Tyr, Y)
n = 16 (2.65%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 29 (4.8%)
Glutamine (Gln, Q)
n = 20 (3.31%)
Histidine (His, H)
n = 12 (1.99%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 36 30 12 30 55 1 5 19 1 2 3 5 0 7 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 4 8 33 7 0 0 18 15 0 3 8 18 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
38 28 2 6 11 17 0 1 12 3 13 2 2 6 23 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 0 2 7 19 1 0 5 4 0 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 169 220 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 188 117 227
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 275 244 75
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.76%)
Alanine (Ala, A)
n = 12 (6.94%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 34 (19.65%)
Leucine (Leu, L)
n = 25 (14.45%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 1 2 0 0 1 8 0 0 17 2 4 11 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 1 5 0 4 3 11 0 5 13 3 0 0 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 4 2 2 4 0 1 6 2 3 14 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 4 0 0 1 1 0 0 4 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 13 15 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 32 17 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
65 10 26 73
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 221 (5.82%)
Alanine (Ala, A)
n = 290 (7.64%)
Serine (Ser, S)
n = 279 (7.35%)
Threonine (Thr, T)
n = 368 (9.69%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 162 (4.27%)
Leucine (Leu, L)
n = 671 (17.67%)
Isoleucine (Ile, I)
n = 290 (7.64%)
Methionine (Met, M)
n = 168 (4.42%)
Proline (Pro, P)
n = 225 (5.93%)
Phenylalanine (Phe, F)
n = 216 (5.69%)
Tyrosine (Tyr, Y)
n = 115 (3.03%)
Tryptophan (Trp, W)
n = 108 (2.84%)
Aspartic acid (Asp, D)
n = 62 (1.63%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 130 (3.42%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 105 (2.77%)
Lysine (Lys, K)
n = 88 (2.32%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
81 209 141 68 172 312 29 71 88 7 38 45 65 14 64 152
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
27 7 22 52 135 100 3 39 72 87 23 34 81 102 8 49
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
163 150 6 37 87 96 5 7 47 37 78 11 19 24 106 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
75 81 11 22 40 75 13 6 23 40 4 2 2 6 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
827 1079 1102 790
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
489 1108 694 1507
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
183 1507 1513 595

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.