Viewing data for Callorhinchus milii


Scientific name Callorhinchus milii
Common name Elephant fish
Maximum lifespan 6.00 years (Callorhinchus milii@AnAge)

Total mtDNA (size: 16769 bases) GC AT G C A T
Base content (bases) 5651 11104 3492 2159 5685 5419
Base content per 1 kb (bases) 337 662 208 129 339 323
Base content (%) 33.7% 66.2%
Total protein-coding genes (size: 11374 bases) GC AT G C A T
Base content (bases) 3710 7651 2418 1292 4118 3533
Base content per 1 kb (bases) 326 673 213 114 362 311
Base content (%) 32.6% 67.3%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1535 bases) GC AT G C A T
Base content (bases) 512 1023 293 219 465 558
Base content per 1 kb (bases) 334 666 191 143 303 364
Base content (%) 33.4% 66.6%
Total rRNA-coding genes (size: 2567 bases) GC AT G C A T
Base content (bases) 992 1575 535 457 662 913
Base content per 1 kb (bases) 386 614 208 178 258 356
Base content (%) 38.6% 61.4%
12S rRNA gene (size: 943 bases) GC AT G C A T
Base content (bases) 400 543 223 177 236 307
Base content per 1 kb (bases) 424 576 236 188 250 326
Base content (%) 42.4% 57.6%
16S rRNA gene (size: 1624 bases) GC AT G C A T
Base content (bases) 592 1032 312 280 426 606
Base content per 1 kb (bases) 365 635 192 172 262 373
Base content (%) 36.5% 63.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 215 469 154 61 251 218
Base content per 1 kb (bases) 314 686 225 89 367 319
Base content (%) 31.4% 68.6%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 39 126 32 7 62 64
Base content per 1 kb (bases) 236 764 194 42 376 388
Base content (%) 23.6% 76.4%
COX1 (size: 1560 bases) GC AT G C A T
Base content (bases) 553 1007 321 232 582 425
Base content per 1 kb (bases) 354 646 206 149 373 272
Base content (%) 35.4% 64.6%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 239 439 146 93 224 215
Base content per 1 kb (bases) 346 635 211 135 324 311
Base content (%) 34.6% 63.5%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 280 506 164 116 283 223
Base content per 1 kb (bases) 356 644 209 148 360 284
Base content (%) 35.6% 64.4%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 386 754 246 140 436 318
Base content per 1 kb (bases) 339 661 216 123 382 279
Base content (%) 33.9% 66.1%
ND1 (size: 960 bases) GC AT G C A T
Base content (bases) 329 631 217 112 354 277
Base content per 1 kb (bases) 343 657 226 117 369 289
Base content (%) 34.3% 65.7%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 328 714 235 93 364 350
Base content per 1 kb (bases) 315 685 226 89 349 336
Base content (%) 31.5% 68.5%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 116 233 74 42 144 89
Base content per 1 kb (bases) 332 668 212 120 413 255
Base content (%) 33.2% 66.8%
ND4 (size: 1376 bases) GC AT G C A T
Base content (bases) 440 936 296 144 494 442
Base content per 1 kb (bases) 320 680 215 105 359 321
Base content (%) 32.0% 68.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 99 198 65 34 112 86
Base content per 1 kb (bases) 333 667 219 114 377 290
Base content (%) 33.3% 66.7%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 530 1294 354 176 692 602
Base content per 1 kb (bases) 291 709 194 96 379 330
Base content (%) 29.1% 70.9%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 159 363 115 44 128 235
Base content per 1 kb (bases) 305 695 220 84 245 450
Base content (%) 30.5% 69.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (2.64%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 13 (5.73%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 12 13 3 19 0 24 8 0 4 1 6 0 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 12 2 3 0 3 1 2 0 6 2 7 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 8 0 2 1 3 0 4 1 2 2 0 0 10 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 1 0 3 0 1 0 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 65 73 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 60 37 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 29 108 90
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPHPWFMIFLFTWIIFLTILPNKIYKHVYTNKPSINITLPKLNNWNWPWI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 1 (1.85%)
Threonine (Thr, T)
n = 4 (7.41%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.85%)
Leucine (Leu, L)
n = 6 (11.11%)
Isoleucine (Ile, I)
n = 8 (14.81%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 7 (12.96%)
Phenylalanine (Phe, F)
n = 4 (7.41%)
Tyrosine (Tyr, Y)
n = 2 (3.7%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 7 (12.96%)
Glutamine (Gln, Q)
n = 1 (1.85%)
Histidine (His, H)
n = 2 (3.7%)
Lysine (Lys, K)
n = 4 (7.41%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 2 1 1 0 1 0 4 1 0 0 1 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 2 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 0 1 0 0 0 0 2 0 0 0 7 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 12 25 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 12 17 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 8 22 24
COX1 (size: 1560 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.06%)
Alanine (Ala, A)
n = 41 (7.9%)
Serine (Ser, S)
n = 31 (5.97%)
Threonine (Thr, T)
n = 38 (7.32%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.55%)
Leucine (Leu, L)
n = 66 (12.72%)
Isoleucine (Ile, I)
n = 42 (8.09%)
Methionine (Met, M)
n = 28 (5.39%)
Proline (Pro, P)
n = 28 (5.39%)
Phenylalanine (Phe, F)
n = 40 (7.71%)
Tyrosine (Tyr, Y)
n = 17 (3.28%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 15 (2.89%)
Glutamic acid (Glu, E)
n = 9 (1.73%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 8 (1.54%)
Histidine (His, H)
n = 21 (4.05%)
Lysine (Lys, K)
n = 10 (1.93%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 15 28 24 2 13 0 27 7 1 15 6 12 1 25 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 1 21 9 11 0 22 6 19 0 19 1 7 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 17 2 17 5 5 0 2 2 12 5 1 0 12 6 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 0 14 1 9 1 2 0 6 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 104 141 129
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 134 98 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 83 186 243
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 12 (5.24%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 13 (5.68%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 18 (7.86%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 22 (9.61%)
Methionine (Met, M)
n = 10 (4.37%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 10 (4.37%)
Tyrosine (Tyr, Y)
n = 8 (3.49%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 11 (4.8%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 7 (3.06%)
Glutamine (Gln, Q)
n = 10 (4.37%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 4 8 4 3 6 0 14 9 1 7 3 8 0 7 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 3 4 5 0 4 0 3 1 4 4 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 7 0 6 2 4 0 1 2 5 3 0 0 5 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 13 0 6 4 4 0 2 1 2 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 50 57 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 48 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 41 91 82
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.28%)
Alanine (Ala, A)
n = 19 (7.28%)
Serine (Ser, S)
n = 17 (6.51%)
Threonine (Thr, T)
n = 21 (8.05%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 34 (13.03%)
Isoleucine (Ile, I)
n = 17 (6.51%)
Methionine (Met, M)
n = 10 (3.83%)
Proline (Pro, P)
n = 11 (4.21%)
Phenylalanine (Phe, F)
n = 24 (9.2%)
Tyrosine (Tyr, Y)
n = 10 (3.83%)
Tryptophan (Trp, W)
n = 13 (4.98%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 4 (1.53%)
Glutamine (Gln, Q)
n = 9 (3.45%)
Histidine (His, H)
n = 15 (5.75%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 5 8 9 1 12 0 11 9 0 7 0 8 1 16 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 8 3 8 0 9 4 5 1 6 1 4 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 11 0 6 1 6 0 3 1 7 3 1 1 3 1 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 0 3 1 2 0 0 0 5 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 62 58 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 64 54 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 38 111 107
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 21 (5.54%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 38 (10.03%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 35 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (3.17%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 7 (1.85%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 24 (6.33%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 11 12 12 6 12 2 23 8 0 8 2 11 0 26 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 0 9 6 6 2 16 2 6 0 6 8 5 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 1 7 8 5 1 0 1 10 2 0 1 16 8 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 6 1 9 0 1 2 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 81 111 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 89 79 165
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 76 128 164
ND1 (size: 960 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.7%)
Alanine (Ala, A)
n = 25 (7.84%)
Serine (Ser, S)
n = 26 (8.15%)
Threonine (Thr, T)
n = 19 (5.96%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 14 (4.39%)
Leucine (Leu, L)
n = 65 (20.38%)
Isoleucine (Ile, I)
n = 27 (8.46%)
Methionine (Met, M)
n = 17 (5.33%)
Proline (Pro, P)
n = 22 (6.9%)
Phenylalanine (Phe, F)
n = 15 (4.7%)
Tyrosine (Tyr, Y)
n = 13 (4.08%)
Tryptophan (Trp, W)
n = 8 (2.51%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 12 (3.76%)
Asparagine (Asn, N)
n = 13 (4.08%)
Glutamine (Gln, Q)
n = 5 (1.57%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 8 (2.51%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 8 15 20 5 17 0 23 5 0 5 4 5 0 10 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 13 3 9 0 6 5 3 1 9 4 9 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 7 0 9 4 10 0 3 0 12 1 0 0 11 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 1 3 1 6 1 1 1 5 1 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 80 86 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 89 58 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 48 133 132
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 24 (6.94%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 69 (19.94%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 25 (7.23%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 13 24 17 7 15 1 29 10 2 1 2 3 0 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 12 5 7 0 6 0 8 1 7 3 9 0 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 18 0 11 3 7 0 2 3 7 1 0 0 14 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 6 1 1 0 10 1 2 0 1 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 79 133 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 104 60 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 52 157 131
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 24 (6.94%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 69 (19.94%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 25 (7.23%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 13 24 17 7 15 1 29 10 2 1 2 3 0 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 12 5 7 0 6 0 8 1 7 3 9 0 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 18 0 11 3 7 0 2 3 7 1 0 0 14 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 6 1 1 0 10 1 2 0 1 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 79 133 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 104 60 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 52 157 131
ND4 (size: 1376 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.38%)
Alanine (Ala, A)
n = 28 (6.13%)
Serine (Ser, S)
n = 40 (8.75%)
Threonine (Thr, T)
n = 40 (8.75%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 11 (2.41%)
Leucine (Leu, L)
n = 83 (18.16%)
Isoleucine (Ile, I)
n = 54 (11.82%)
Methionine (Met, M)
n = 30 (6.56%)
Proline (Pro, P)
n = 23 (5.03%)
Phenylalanine (Phe, F)
n = 18 (3.94%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 18 (3.94%)
Aspartic acid (Asp, D)
n = 4 (0.88%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 18 (3.94%)
Glutamine (Gln, Q)
n = 10 (2.19%)
Histidine (His, H)
n = 11 (2.41%)
Lysine (Lys, K)
n = 11 (2.41%)
Arginine (Arg, R)
n = 11 (2.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
39 15 29 17 3 21 2 40 10 0 2 2 7 0 13 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 2 10 8 9 1 7 2 10 1 9 4 9 1 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 0 12 8 12 0 5 3 9 5 1 0 11 7 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 7 2 2 2 10 1 2 2 7 0 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 98 161 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 123 77 196
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 75 203 170
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 11 (11.22%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 4 7 3 3 0 11 2 0 1 0 0 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 1 1 2 5 0 4 0 0 0 1 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 0 2 4 0 5 0 2 0 0 0 5 0 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 0 0 0 0 0 1 1 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 23 31 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 27 17 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 15 38 44
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.78%)
Alanine (Ala, A)
n = 36 (5.93%)
Serine (Ser, S)
n = 48 (7.91%)
Threonine (Thr, T)
n = 44 (7.25%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 14 (2.31%)
Leucine (Leu, L)
n = 92 (15.16%)
Isoleucine (Ile, I)
n = 75 (12.36%)
Methionine (Met, M)
n = 39 (6.43%)
Proline (Pro, P)
n = 25 (4.12%)
Phenylalanine (Phe, F)
n = 37 (6.1%)
Tyrosine (Tyr, Y)
n = 20 (3.29%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.81%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 42 (6.92%)
Glutamine (Gln, Q)
n = 15 (2.47%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 29 (4.78%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
52 23 37 26 8 17 0 41 15 0 7 2 5 0 29 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 4 2 17 12 7 0 13 4 11 1 13 4 7 1 27
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 14 0 18 7 12 1 4 6 13 7 2 0 35 7 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 1 9 2 29 0 3 2 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 112 239 155
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 143 142 257
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 99 221 280
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (11.56%)
Alanine (Ala, A)
n = 11 (6.36%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 20 (11.56%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 7 (4.05%)
Methionine (Met, M)
n = 13 (7.51%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 13 (7.51%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 5 (2.89%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 0 9 5 0 0 0 22 0 0 10 0 6 4 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 8 0 3 0 6 0 11 3 2 0 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 6 0 2 0 4 0 9 0 2 4 5 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 5 0 4 0 0 0 0 0 2 2 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 16 33 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 28 26 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 0 69 86
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.61%)
Alanine (Ala, A)
n = 252 (6.64%)
Serine (Ser, S)
n = 269 (7.09%)
Threonine (Thr, T)
n = 286 (7.53%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 169 (4.45%)
Leucine (Leu, L)
n = 640 (16.86%)
Isoleucine (Ile, I)
n = 361 (9.51%)
Methionine (Met, M)
n = 209 (5.51%)
Proline (Pro, P)
n = 199 (5.24%)
Phenylalanine (Phe, F)
n = 235 (6.19%)
Tyrosine (Tyr, Y)
n = 121 (3.19%)
Tryptophan (Trp, W)
n = 115 (3.03%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 175 (4.61%)
Glutamine (Gln, Q)
n = 91 (2.4%)
Histidine (His, H)
n = 100 (2.63%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 70 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
253 107 188 160 44 143 6 280 86 5 68 23 72 6 169 66
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
21 23 6 118 55 76 3 98 25 80 9 90 33 69 6 127
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
41 114 3 98 43 71 3 34 19 92 29 7 6 136 39 73
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
27 89 6 50 13 88 4 15 10 41 3 0 1 7 1 107
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
791 811 1175 1008
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
478 950 745 1612
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
90 580 1511 1604

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.