Viewing data for Sphyraena barracuda


Scientific name Sphyraena barracuda
Common name Great barracuda
Maximum lifespan 14.00 years (Sphyraena barracuda@AnAge)

Total mtDNA (size: 16707 bases) GC AT G C A T
Base content (bases) 7662 9045 4959 2703 4216 4829
Base content per 1 kb (bases) 459 541 297 162 252 289
Base content (%) 45.9% 54.1%
Total protein-coding genes (size: 11423 bases) GC AT G C A T
Base content (bases) 5285 6138 3635 1650 2955 3183
Base content per 1 kb (bases) 463 537 318 144 259 279
Base content (%) 46.3% 53.7%
D-loop (size: 809 bases) GC AT G C A T
Base content (bases) 331 478 175 156 232 246
Base content per 1 kb (bases) 409 591 216 193 287 304
Base content (%) 40.9% 59.1%
Total tRNA-coding genes (size: 1557 bases) GC AT G C A T
Base content (bases) 697 860 384 313 383 477
Base content per 1 kb (bases) 448 552 247 201 246 306
Base content (%) 44.8% 55.2%
Total rRNA-coding genes (size: 2696 bases) GC AT G C A T
Base content (bases) 1255 1441 695 560 593 848
Base content per 1 kb (bases) 466 534 258 208 220 315
Base content (%) 46.6% 53.4%
12S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 471 482 254 217 205 277
Base content per 1 kb (bases) 494 506 267 228 215 291
Base content (%) 49.4% 50.6%
16S rRNA gene (size: 1743 bases) GC AT G C A T
Base content (bases) 784 959 441 343 388 571
Base content per 1 kb (bases) 450 550 253 197 223 328
Base content (%) 45.0% 55.0%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 308 375 223 85 186 189
Base content per 1 kb (bases) 451 549 327 124 272 277
Base content (%) 45.1% 54.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 76 92 59 17 36 56
Base content per 1 kb (bases) 452 548 351 101 214 333
Base content (%) 45.2% 54.8%
COX1 (size: 1563 bases) GC AT G C A T
Base content (bases) 717 846 438 279 462 384
Base content per 1 kb (bases) 459 541 280 179 296 246
Base content (%) 45.9% 54.1%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 316 375 199 117 184 191
Base content per 1 kb (bases) 457 543 288 169 266 276
Base content (%) 45.7% 54.3%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 382 403 247 135 198 205
Base content per 1 kb (bases) 487 513 315 172 252 261
Base content (%) 48.7% 51.3%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 528 613 357 171 315 298
Base content per 1 kb (bases) 463 537 313 150 276 261
Base content (%) 46.3% 53.7%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 457 518 317 140 254 264
Base content per 1 kb (bases) 469 531 325 144 261 271
Base content (%) 46.9% 53.1%
ND2 (size: 1050 bases) GC AT G C A T
Base content (bases) 487 563 360 127 253 310
Base content per 1 kb (bases) 464 536 343 121 241 295
Base content (%) 46.4% 53.6%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 167 182 118 49 105 77
Base content per 1 kb (bases) 479 521 338 140 301 221
Base content (%) 47.9% 52.1%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 636 745 449 187 356 389
Base content per 1 kb (bases) 461 539 325 135 258 282
Base content (%) 46.1% 53.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 139 158 99 40 86 72
Base content per 1 kb (bases) 468 532 333 135 290 242
Base content (%) 46.8% 53.2%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 839 1000 599 240 456 544
Base content per 1 kb (bases) 456 544 326 131 248 296
Base content (%) 45.6% 54.4%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 238 284 173 65 70 214
Base content per 1 kb (bases) 456 544 331 125 134 410
Base content (%) 45.6% 54.4%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 6 (2.65%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.64%)
Leucine (Leu, L)
n = 52 (23.01%)
Isoleucine (Ile, I)
n = 18 (7.96%)
Methionine (Met, M)
n = 9 (3.98%)
Proline (Pro, P)
n = 18 (7.96%)
Phenylalanine (Phe, F)
n = 14 (6.19%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 10 (4.42%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 6 8 11 21 6 6 10 0 4 3 7 1 5 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 10 6 0 2 3 5 0 7 5 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 0 0 2 0 0 0 4 1 3 0 0 0 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 1 0 1 1 3 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 84 63 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 61 33 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 78 92 46
ATP8 (size: 168 bases)
Amino acid sequence: MPQLDPAPWFPILILCWTVFLIFIPPKVMAHTQPNQPTPQSAEKSKETPWTWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 1 (1.82%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 1 (1.82%)
Glutamine (Gln, Q)
n = 4 (7.27%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 1 1 1 1 1 0 4 0 0 1 1 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 0 1 2 0 0 0 0 0 3 5 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 0 1 0 0 1 0 0 1 0 0 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
8 20 16 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 20 14 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 19 26 9
COX1 (size: 1563 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.85%)
Alanine (Ala, A)
n = 48 (9.23%)
Serine (Ser, S)
n = 30 (5.77%)
Threonine (Thr, T)
n = 36 (6.92%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.69%)
Leucine (Leu, L)
n = 61 (11.73%)
Isoleucine (Ile, I)
n = 42 (8.08%)
Methionine (Met, M)
n = 25 (4.81%)
Proline (Pro, P)
n = 27 (5.19%)
Phenylalanine (Phe, F)
n = 44 (8.46%)
Tyrosine (Tyr, Y)
n = 17 (3.27%)
Tryptophan (Trp, W)
n = 18 (3.46%)
Aspartic acid (Asp, D)
n = 14 (2.69%)
Glutamic acid (Glu, E)
n = 11 (2.12%)
Asparagine (Asn, N)
n = 15 (2.88%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 21 (4.04%)
Lysine (Lys, K)
n = 8 (1.54%)
Arginine (Arg, R)
n = 9 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 21 12 13 11 21 7 6 6 1 7 14 14 5 21 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 0 1 10 22 16 0 11 11 18 6 12 9 5 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 12 0 5 11 8 1 0 5 8 9 2 3 6 9 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 11 0 2 12 8 0 3 0 6 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
159 116 132 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 136 93 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 186 159 136
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.49%)
Alanine (Ala, A)
n = 19 (8.3%)
Serine (Ser, S)
n = 14 (6.11%)
Threonine (Thr, T)
n = 13 (5.68%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 17 (7.42%)
Leucine (Leu, L)
n = 30 (13.1%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 11 (4.8%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 14 (6.11%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 11 (4.8%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 8 10 6 7 2 4 6 2 6 6 3 2 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 7 5 5 2 0 2 5 1 2 5 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 5 0 3 4 2 1 1 3 1 9 0 1 1 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 3 5 9 2 2 0 3 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 64 54 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 56 65 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 79 72 59
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 25 (9.62%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 19 (7.31%)
Leucine (Leu, L)
n = 28 (10.77%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 8 (3.08%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 7 (2.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 5 10 3 10 11 2 2 5 2 4 5 9 1 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 10 11 0 2 9 9 1 4 7 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 1 0 9 2 0 0 3 1 7 0 0 0 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 3 2 3 0 1 2 2 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 71 56 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 71 50 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 105 98 46
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 29 (7.65%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 27 (7.12%)
Leucine (Leu, L)
n = 63 (16.62%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 19 (5.01%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 14 6 7 22 19 8 5 6 0 9 8 10 0 11 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 3 11 15 0 1 11 13 2 3 7 10 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 7 1 2 8 11 0 0 2 3 10 1 2 6 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 2 8 9 0 1 1 5 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 103 92 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 95 74 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 159 132 68
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 33 (10.19%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 21 (6.48%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (5.56%)
Leucine (Leu, L)
n = 64 (19.75%)
Isoleucine (Ile, I)
n = 24 (7.41%)
Methionine (Met, M)
n = 12 (3.7%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 10 9 10 17 24 6 5 7 0 2 7 8 1 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 14 14 1 2 4 9 3 3 13 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 5 0 2 7 8 0 2 2 2 9 0 2 3 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 1 3 6 1 0 1 7 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 100 79 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 95 56 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 122 129 56
ND2 (size: 1050 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.16%)
Alanine (Ala, A)
n = 32 (9.17%)
Serine (Ser, S)
n = 24 (6.88%)
Threonine (Thr, T)
n = 44 (12.61%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.44%)
Leucine (Leu, L)
n = 75 (21.49%)
Isoleucine (Ile, I)
n = 25 (7.16%)
Methionine (Met, M)
n = 16 (4.58%)
Proline (Pro, P)
n = 22 (6.3%)
Phenylalanine (Phe, F)
n = 13 (3.72%)
Tyrosine (Tyr, Y)
n = 7 (2.01%)
Tryptophan (Trp, W)
n = 11 (3.15%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 5 (1.43%)
Asparagine (Asn, N)
n = 9 (2.58%)
Glutamine (Gln, Q)
n = 13 (3.72%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 8 (2.29%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 12 9 11 21 30 3 10 13 0 3 5 4 0 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 2 22 8 0 0 6 12 0 2 12 8 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 20 3 1 7 9 2 0 5 2 5 1 0 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 4 7 1 0 0 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 110 107 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 117 53 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 133 150 50
ND3 (size: 1050 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.16%)
Alanine (Ala, A)
n = 32 (9.17%)
Serine (Ser, S)
n = 24 (6.88%)
Threonine (Thr, T)
n = 44 (12.61%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.44%)
Leucine (Leu, L)
n = 75 (21.49%)
Isoleucine (Ile, I)
n = 25 (7.16%)
Methionine (Met, M)
n = 16 (4.58%)
Proline (Pro, P)
n = 22 (6.3%)
Phenylalanine (Phe, F)
n = 13 (3.72%)
Tyrosine (Tyr, Y)
n = 7 (2.01%)
Tryptophan (Trp, W)
n = 11 (3.15%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 5 (1.43%)
Asparagine (Asn, N)
n = 9 (2.58%)
Glutamine (Gln, Q)
n = 13 (3.72%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 8 (2.29%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 12 9 11 21 30 3 10 13 0 3 5 4 0 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 2 22 8 0 0 6 12 0 2 12 8 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 20 3 1 7 9 2 0 5 2 5 1 0 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 4 7 1 0 0 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 110 107 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 117 53 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 133 150 50
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (5.88%)
Alanine (Ala, A)
n = 33 (7.19%)
Serine (Ser, S)
n = 30 (6.54%)
Threonine (Thr, T)
n = 46 (10.02%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 13 (2.83%)
Leucine (Leu, L)
n = 96 (20.92%)
Isoleucine (Ile, I)
n = 39 (8.5%)
Methionine (Met, M)
n = 23 (5.01%)
Proline (Pro, P)
n = 25 (5.45%)
Phenylalanine (Phe, F)
n = 18 (3.92%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 15 (3.27%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 13 (2.83%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 20 16 15 27 34 12 7 10 1 2 4 7 0 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 3 4 10 18 1 3 12 9 3 3 12 10 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 16 0 1 16 5 0 2 6 1 12 2 1 4 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 3 0 3 9 0 1 4 6 0 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 148 140 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 126 76 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 175 173 82
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 25 (25.51%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 3 (3.06%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 2 6 5 10 0 4 1 2 0 0 1 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 7 5 0 0 2 3 0 1 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 1 3 5 0 0 2 0 0 0 0 1 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 1 0 0 0 1 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 34 19 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 31 15 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 34 38 23
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.9%)
Alanine (Ala, A)
n = 55 (8.99%)
Serine (Ser, S)
n = 40 (6.54%)
Threonine (Thr, T)
n = 66 (10.78%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 25 (4.08%)
Leucine (Leu, L)
n = 94 (15.36%)
Isoleucine (Ile, I)
n = 49 (8.01%)
Methionine (Met, M)
n = 32 (5.23%)
Proline (Pro, P)
n = 32 (5.23%)
Phenylalanine (Phe, F)
n = 39 (6.37%)
Tyrosine (Tyr, Y)
n = 13 (2.12%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 28 (4.58%)
Glutamine (Gln, Q)
n = 17 (2.78%)
Histidine (His, H)
n = 17 (2.78%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 24 24 10 37 35 5 7 15 2 4 4 13 4 13 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 5 7 29 15 4 5 13 12 0 4 17 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 29 3 5 15 7 1 3 9 2 11 2 0 8 20 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 2 5 8 19 1 0 3 6 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
135 163 207 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 181 121 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 255 216 109
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 15 (8.67%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 26 (15.03%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 2 3 0 0 1 6 0 0 12 1 4 9 11 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 8 1 3 3 10 1 5 9 3 2 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 8 0 1 2 2 0 9 0 2 18 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 5 2 0 0 0 0 1 1 3 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 16 20 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 37 20 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 12 30 73
Total protein-coding genes (size: 11444 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 241 (6.32%)
Alanine (Ala, A)
n = 332 (8.71%)
Serine (Ser, S)
n = 236 (6.19%)
Threonine (Thr, T)
n = 316 (8.29%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 218 (5.72%)
Leucine (Leu, L)
n = 650 (17.06%)
Isoleucine (Ile, I)
n = 280 (7.35%)
Methionine (Met, M)
n = 166 (4.36%)
Proline (Pro, P)
n = 224 (5.88%)
Phenylalanine (Phe, F)
n = 234 (6.14%)
Tyrosine (Tyr, Y)
n = 109 (2.86%)
Tryptophan (Trp, W)
n = 121 (3.18%)
Aspartic acid (Asp, D)
n = 76 (1.99%)
Glutamic acid (Glu, E)
n = 98 (2.57%)
Asparagine (Asn, N)
n = 118 (3.1%)
Glutamine (Gln, Q)
n = 96 (2.52%)
Histidine (His, H)
n = 112 (2.94%)
Lysine (Lys, K)
n = 73 (1.92%)
Arginine (Arg, R)
n = 79 (2.07%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
146 134 106 101 177 221 56 67 86 10 53 61 81 23 97 137
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
60 7 19 54 147 120 11 37 76 103 25 48 100 71 5 59
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
123 126 8 29 89 58 7 12 41 31 78 10 28 32 86 41
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
71 82 16 22 54 68 5 8 16 47 8 0 1 5 1 111
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
965 1066 1007 774
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
521 1055 688 1548
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
274 1409 1352 777

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.