Viewing data for Aldrichetta forsteri


Scientific name Aldrichetta forsteri
Common name Yellow-eye mullet
Maximum lifespan 7.00 years (Aldrichetta forsteri@AnAge)

Total mtDNA (size: 16797 bases) GC AT G C A T
Base content (bases) 7605 9192 4861 2744 4501 4691
Base content per 1 kb (bases) 453 547 289 163 268 279
Base content (%) 45.3% 54.7%
Total protein-coding genes (size: 11456 bases) GC AT G C A T
Base content (bases) 5300 6156 3557 1743 3200 2956
Base content per 1 kb (bases) 463 537 310 152 279 258
Base content (%) 46.3% 53.7%
D-loop (size: 1055 bases) GC AT G C A T
Base content (bases) 367 688 216 151 323 365
Base content per 1 kb (bases) 348 652 205 143 306 346
Base content (%) 34.8% 65.2%
Total tRNA-coding genes (size: 1553 bases) GC AT G C A T
Base content (bases) 674 879 376 298 390 489
Base content per 1 kb (bases) 434 566 242 192 251 315
Base content (%) 43.4% 56.6%
Total rRNA-coding genes (size: 2637 bases) GC AT G C A T
Base content (bases) 1213 1424 675 538 572 852
Base content per 1 kb (bases) 460 540 256 204 217 323
Base content (%) 46.0% 54.0%
12S rRNA gene (size: 952 bases) GC AT G C A T
Base content (bases) 447 505 245 202 206 299
Base content per 1 kb (bases) 470 530 257 212 216 314
Base content (%) 47.0% 53.0%
16S rRNA gene (size: 1685 bases) GC AT G C A T
Base content (bases) 766 919 430 336 366 553
Base content per 1 kb (bases) 455 545 255 199 217 328
Base content (%) 45.5% 54.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 322 362 232 90 188 174
Base content per 1 kb (bases) 471 529 339 132 275 254
Base content (%) 47.1% 52.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 73 95 57 16 43 52
Base content per 1 kb (bases) 435 565 339 95 256 310
Base content (%) 43.5% 56.5%
COX1 (size: 1596 bases) GC AT G C A T
Base content (bases) 731 865 434 297 473 392
Base content per 1 kb (bases) 458 542 272 186 296 246
Base content (%) 45.8% 54.2%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 300 391 188 112 197 194
Base content per 1 kb (bases) 434 566 272 162 285 281
Base content (%) 43.4% 56.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 366 418 233 133 221 197
Base content per 1 kb (bases) 467 533 297 170 282 251
Base content (%) 46.7% 53.3%
CYTB (size: 1138 bases) GC AT G C A T
Base content (bases) 524 614 348 176 334 280
Base content per 1 kb (bases) 460 540 306 155 293 246
Base content (%) 46.0% 54.0%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 446 529 293 153 293 236
Base content per 1 kb (bases) 457 543 301 157 301 242
Base content (%) 45.7% 54.3%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 509 536 371 138 269 267
Base content per 1 kb (bases) 487 513 355 132 257 256
Base content (%) 48.7% 51.3%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 164 185 107 57 112 73
Base content per 1 kb (bases) 470 530 307 163 321 209
Base content (%) 47.0% 53.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 649 732 451 198 376 356
Base content per 1 kb (bases) 470 530 327 143 272 258
Base content (%) 47.0% 53.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 142 155 94 48 87 68
Base content per 1 kb (bases) 478 522 316 162 293 229
Base content (%) 47.8% 52.2%
ND5 (size: 1848 bases) GC AT G C A T
Base content (bases) 835 1013 578 257 522 491
Base content per 1 kb (bases) 452 548 313 139 282 266
Base content (%) 45.2% 54.8%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 244 278 174 70 91 187
Base content per 1 kb (bases) 467 533 333 134 174 358
Base content (%) 46.7% 53.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 20 (8.81%)
Serine (Ser, S)
n = 9 (3.96%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 55 (24.23%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 14 (6.17%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 8 5 10 15 18 4 8 9 1 3 7 2 2 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 9 7 0 0 8 1 0 3 7 4 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 4 2 1 0 1 0 5 0 3 0 0 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 2 0 0 2 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 82 63 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 61 34 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 89 77 44
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFLILVFSWFVFLTIIPPKILAHTYPNEPASQSTEKPKTETWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 0 2 1 2 0 0 2 0 0 1 1 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 3 0 0 0 0 0 0 4 2 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 1 0 2 0 0 0 0 1 0 2 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 1 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
8 17 17 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 19 15 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 21 20 13
COX1 (size: 1596 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (8.85%)
Alanine (Ala, A)
n = 43 (8.1%)
Serine (Ser, S)
n = 33 (6.21%)
Threonine (Thr, T)
n = 38 (7.16%)
Cysteine (Cys, C)
n = 2 (0.38%)
Valine (Val, V)
n = 43 (8.1%)
Leucine (Leu, L)
n = 64 (12.05%)
Isoleucine (Ile, I)
n = 39 (7.34%)
Methionine (Met, M)
n = 26 (4.9%)
Proline (Pro, P)
n = 31 (5.84%)
Phenylalanine (Phe, F)
n = 40 (7.53%)
Tyrosine (Tyr, Y)
n = 19 (3.58%)
Tryptophan (Trp, W)
n = 18 (3.39%)
Aspartic acid (Asp, D)
n = 17 (3.2%)
Glutamic acid (Glu, E)
n = 12 (2.26%)
Asparagine (Asn, N)
n = 14 (2.64%)
Glutamine (Gln, Q)
n = 8 (1.51%)
Histidine (His, H)
n = 20 (3.77%)
Lysine (Lys, K)
n = 9 (1.69%)
Arginine (Arg, R)
n = 8 (1.51%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 21 13 16 10 19 9 10 4 4 9 11 19 4 20 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 0 2 13 13 13 4 5 14 15 13 13 10 6 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 15 0 12 8 7 1 0 5 9 10 0 0 6 8 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 2 4 13 6 3 3 0 5 0 0 0 1 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
162 121 131 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 140 100 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 173 161 143
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 11 (4.8%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 17 (7.42%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 20 (8.73%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 11 (4.8%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 9 (3.93%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 7 10 10 4 7 3 5 7 1 4 5 4 4 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 6 7 0 1 4 2 2 3 5 5 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 7 0 6 4 2 1 1 3 4 5 0 0 3 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 2 3 10 3 0 0 3 2 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 61 55 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 54 61 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 73 78 62
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 9 5 5 5 10 3 7 8 1 4 6 6 2 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 9 10 0 2 11 6 2 6 2 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 1 5 4 2 0 0 3 4 8 0 1 1 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 0 1 4 2 0 1 0 2 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 66 51 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 99 91 56
CYTB (size: 1138 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.35%)
Alanine (Ala, A)
n = 32 (8.47%)
Serine (Ser, S)
n = 23 (6.08%)
Threonine (Thr, T)
n = 20 (5.29%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 28 (7.41%)
Leucine (Leu, L)
n = 63 (16.67%)
Isoleucine (Ile, I)
n = 27 (7.14%)
Methionine (Met, M)
n = 10 (2.65%)
Proline (Pro, P)
n = 22 (5.82%)
Phenylalanine (Phe, F)
n = 28 (7.41%)
Tyrosine (Tyr, Y)
n = 15 (3.97%)
Tryptophan (Trp, W)
n = 13 (3.44%)
Aspartic acid (Asp, D)
n = 13 (3.44%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 18 (4.76%)
Glutamine (Gln, Q)
n = 5 (1.32%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.38%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 12 4 16 19 19 1 6 4 1 8 10 7 3 8 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 2 11 17 2 2 11 8 3 8 7 6 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 1 8 6 6 1 1 1 6 9 0 2 6 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 1 3 10 9 0 0 1 6 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 102 86 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 95 77 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 151 117 88
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 33 (10.19%)
Serine (Ser, S)
n = 23 (7.1%)
Threonine (Thr, T)
n = 22 (6.79%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 19 (5.86%)
Leucine (Leu, L)
n = 65 (20.06%)
Isoleucine (Ile, I)
n = 23 (7.1%)
Methionine (Met, M)
n = 12 (3.7%)
Proline (Pro, P)
n = 23 (7.1%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 10 (3.09%)
Asparagine (Asn, N)
n = 9 (2.78%)
Glutamine (Gln, Q)
n = 8 (2.47%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 7 (2.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 10 8 14 15 20 2 12 8 0 7 5 5 2 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 7 11 12 3 2 7 4 5 6 10 4 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 5 1 3 8 7 1 3 1 5 6 1 2 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 5 5 1 3 5 2 1 1 4 1 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 91 77 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 97 52 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 105 107 81
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 80 (23.05%)
Isoleucine (Ile, I)
n = 20 (5.76%)
Methionine (Met, M)
n = 13 (3.75%)
Proline (Pro, P)
n = 24 (6.92%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 12 6 27 26 20 2 4 10 4 4 4 3 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 4 22 8 3 1 8 6 3 6 12 5 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 20 3 3 5 9 0 1 2 2 5 2 1 3 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 2 0 0 7 2 1 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 125 99 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 121 55 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 125 113 80
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 80 (23.05%)
Isoleucine (Ile, I)
n = 20 (5.76%)
Methionine (Met, M)
n = 13 (3.75%)
Proline (Pro, P)
n = 24 (6.92%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 12 6 27 26 20 2 4 10 4 4 4 3 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 4 22 8 3 1 8 6 3 6 12 5 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 20 3 3 5 9 0 1 2 2 5 2 1 3 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 2 0 0 7 2 1 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 125 99 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 121 55 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 125 113 80
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (5.45%)
Alanine (Ala, A)
n = 44 (9.59%)
Serine (Ser, S)
n = 33 (7.19%)
Threonine (Thr, T)
n = 39 (8.5%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 15 (3.27%)
Leucine (Leu, L)
n = 96 (20.92%)
Isoleucine (Ile, I)
n = 36 (7.84%)
Methionine (Met, M)
n = 24 (5.23%)
Proline (Pro, P)
n = 25 (5.45%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 17 (3.7%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 13 (2.83%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 18 17 22 28 33 4 8 12 0 5 8 2 0 9 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 4 7 18 18 1 4 13 4 4 7 15 3 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 13 1 4 11 5 2 3 8 6 7 2 1 6 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 6 1 3 9 0 3 3 5 0 0 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
101 146 131 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 130 74 187
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 175 151 106
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 15 (15.31%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 2 6 4 9 0 4 2 0 1 0 0 1 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 8 6 0 1 3 0 1 1 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 1 3 4 0 0 3 0 0 0 1 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 1 0 1 1 0 1 1 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 29 21 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 30 13 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 35 34 22
ND5 (size: 1848 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.88%)
Alanine (Ala, A)
n = 52 (8.46%)
Serine (Ser, S)
n = 51 (8.29%)
Threonine (Thr, T)
n = 54 (8.78%)
Cysteine (Cys, C)
n = 7 (1.14%)
Valine (Val, V)
n = 31 (5.04%)
Leucine (Leu, L)
n = 100 (16.26%)
Isoleucine (Ile, I)
n = 52 (8.46%)
Methionine (Met, M)
n = 23 (3.74%)
Proline (Pro, P)
n = 29 (4.72%)
Phenylalanine (Phe, F)
n = 41 (6.67%)
Tyrosine (Tyr, Y)
n = 15 (2.44%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 14 (2.28%)
Glutamic acid (Glu, E)
n = 11 (1.79%)
Asparagine (Asn, N)
n = 25 (4.07%)
Glutamine (Gln, Q)
n = 18 (2.93%)
Histidine (His, H)
n = 16 (2.6%)
Lysine (Lys, K)
n = 20 (3.25%)
Arginine (Arg, R)
n = 12 (1.95%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 26 19 18 27 31 5 15 14 4 7 13 7 4 18 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 5 2 12 17 21 2 3 20 7 0 6 18 1 4 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 16 2 8 18 9 1 2 13 3 12 1 4 9 16 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 4 3 11 16 4 1 4 5 2 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
138 156 189 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 171 120 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 251 182 142
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.18%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 10 (5.78%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 26 (15.03%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 5 (2.89%)
Methionine (Met, M)
n = 9 (5.2%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 1 (0.58%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 4 5 0 2 4 11 0 0 10 1 9 6 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 9 2 5 1 4 2 5 17 2 1 2 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 3 2 1 0 3 1 4 3 2 9 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 4 1 0 0 0 0 0 2 2 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 21 24 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 33 17 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 16 50 56
Total protein-coding genes (size: 11478 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 240 (6.28%)
Alanine (Ala, A)
n = 342 (8.95%)
Serine (Ser, S)
n = 256 (6.7%)
Threonine (Thr, T)
n = 290 (7.59%)
Cysteine (Cys, C)
n = 28 (0.73%)
Valine (Val, V)
n = 229 (5.99%)
Leucine (Leu, L)
n = 668 (17.47%)
Isoleucine (Ile, I)
n = 271 (7.09%)
Methionine (Met, M)
n = 157 (4.11%)
Proline (Pro, P)
n = 222 (5.81%)
Phenylalanine (Phe, F)
n = 234 (6.12%)
Tyrosine (Tyr, Y)
n = 116 (3.03%)
Tryptophan (Trp, W)
n = 120 (3.14%)
Aspartic acid (Asp, D)
n = 77 (2.01%)
Glutamic acid (Glu, E)
n = 100 (2.62%)
Asparagine (Asn, N)
n = 115 (3.01%)
Glutamine (Gln, Q)
n = 99 (2.59%)
Histidine (His, H)
n = 103 (2.69%)
Lysine (Lys, K)
n = 75 (1.96%)
Arginine (Arg, R)
n = 75 (1.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
140 131 95 156 162 196 41 92 81 18 62 73 66 28 107 127
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
62 10 18 70 131 125 16 26 103 60 51 66 93 45 18 57
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
109 111 13 60 75 53 8 14 46 45 71 10 21 46 69 35
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 70 30 17 60 64 11 12 16 37 10 0 0 6 1 110
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
988 1054 968 814
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
523 1050 692 1559
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
338 1352 1211 923

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.