Viewing data for Anabas testudineus


Scientific name Anabas testudineus
Common name Climbing perch
Maximum lifespan 8.00 years (Anabas testudineus@AnAge)

Total mtDNA (size: 16603 bases) GC AT G C A T
Base content (bases) 7568 9035 4881 2687 4282 4753
Base content per 1 kb (bases) 456 544 294 162 258 286
Base content (%) 45.6% 54.4%
Total protein-coding genes (size: 11418 bases) GC AT G C A T
Base content (bases) 5321 6097 3626 1695 3030 3067
Base content per 1 kb (bases) 466 534 318 148 265 269
Base content (%) 46.6% 53.4%
D-loop (size: 821 bases) GC AT G C A T
Base content (bases) 307 514 189 118 256 258
Base content per 1 kb (bases) 374 626 230 144 312 314
Base content (%) 37.4% 62.6%
Total tRNA-coding genes (size: 1528 bases) GC AT G C A T
Base content (bases) 673 855 371 302 382 473
Base content per 1 kb (bases) 440 560 243 198 250 310
Base content (%) 44.0% 56.0%
Total rRNA-coding genes (size: 2601 bases) GC AT G C A T
Base content (bases) 1177 1424 634 543 565 859
Base content per 1 kb (bases) 453 547 244 209 217 330
Base content (%) 45.3% 54.7%
12S rRNA gene (size: 948 bases) GC AT G C A T
Base content (bases) 460 488 246 214 193 295
Base content per 1 kb (bases) 485 515 259 226 204 311
Base content (%) 48.5% 51.5%
16S rRNA gene (size: 1653 bases) GC AT G C A T
Base content (bases) 717 936 388 329 372 564
Base content per 1 kb (bases) 434 566 235 199 225 341
Base content (%) 43.4% 56.6%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 329 354 232 97 188 166
Base content per 1 kb (bases) 482 518 340 142 275 243
Base content (%) 48.2% 51.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 56 14 45 53
Base content per 1 kb (bases) 417 583 333 83 268 315
Base content (%) 41.7% 58.3%
COX1 (size: 1560 bases) GC AT G C A T
Base content (bases) 704 856 422 282 475 381
Base content per 1 kb (bases) 451 549 271 181 304 244
Base content (%) 45.1% 54.9%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 305 386 201 104 183 203
Base content per 1 kb (bases) 441 559 291 151 265 294
Base content (%) 44.1% 55.9%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 369 416 242 127 212 204
Base content per 1 kb (bases) 470 530 308 162 270 260
Base content (%) 47.0% 53.0%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 532 611 359 173 321 290
Base content per 1 kb (bases) 465 535 314 151 281 254
Base content (%) 46.5% 53.5%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 459 516 313 146 264 252
Base content per 1 kb (bases) 471 529 321 150 271 258
Base content (%) 47.1% 52.9%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 507 539 369 138 255 284
Base content per 1 kb (bases) 485 515 353 132 244 272
Base content (%) 48.5% 51.5%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 172 177 119 53 106 71
Base content per 1 kb (bases) 493 507 341 152 304 203
Base content (%) 49.3% 50.7%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 651 730 460 191 347 383
Base content per 1 kb (bases) 471 529 333 138 251 277
Base content (%) 47.1% 52.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 99 47 83 68
Base content per 1 kb (bases) 492 508 333 158 279 229
Base content (%) 49.2% 50.8%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 833 1006 582 251 481 525
Base content per 1 kb (bases) 453 547 316 136 262 285
Base content (%) 45.3% 54.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 250 272 175 75 76 196
Base content per 1 kb (bases) 479 521 335 144 146 375
Base content (%) 47.9% 52.1%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 23 (10.18%)
Serine (Ser, S)
n = 6 (2.65%)
Threonine (Thr, T)
n = 20 (8.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 55 (24.34%)
Isoleucine (Ile, I)
n = 16 (7.08%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 18 (7.96%)
Phenylalanine (Phe, F)
n = 14 (6.19%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 4 (1.77%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 7 (3.1%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 7 6 14 15 13 6 6 6 2 1 5 5 1 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 4 11 6 2 1 5 0 4 4 4 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 0 0 2 0 0 0 4 2 1 0 1 3 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 0 1 0 4 3 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 85 62 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 63 31 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 84 72 49
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWLLILLFSWLVFLTIIPQKVLAHTFPNDPAPKTSKTFKMETWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 1 1 3 1 0 3 1 1 0 2 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 3 0 0 0 0 0 0 1 4 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 0 1 0 1 0 0 0 0 1 0 0 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 1 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 16 17 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 18 14 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 22 22 10
COX1 (size: 1560 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.48%)
Alanine (Ala, A)
n = 49 (9.44%)
Serine (Ser, S)
n = 29 (5.59%)
Threonine (Thr, T)
n = 35 (6.74%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 45 (8.67%)
Leucine (Leu, L)
n = 63 (12.14%)
Isoleucine (Ile, I)
n = 36 (6.94%)
Methionine (Met, M)
n = 25 (4.82%)
Proline (Pro, P)
n = 30 (5.78%)
Phenylalanine (Phe, F)
n = 42 (8.09%)
Tyrosine (Tyr, Y)
n = 19 (3.66%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 15 (2.89%)
Glutamic acid (Glu, E)
n = 11 (2.12%)
Asparagine (Asn, N)
n = 14 (2.7%)
Glutamine (Gln, Q)
n = 8 (1.54%)
Histidine (His, H)
n = 19 (3.66%)
Lysine (Lys, K)
n = 8 (1.54%)
Arginine (Arg, R)
n = 9 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 13 16 25 11 12 2 12 6 2 12 8 19 6 16 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 15 16 17 1 11 11 13 9 9 8 10 3 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 0 8 12 3 1 0 5 5 14 3 1 6 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 8 3 6 9 8 0 2 0 5 2 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
164 116 123 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 138 95 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 168 163 147
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.49%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 14 (6.11%)
Threonine (Thr, T)
n = 12 (5.24%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 13 (5.68%)
Leucine (Leu, L)
n = 31 (13.54%)
Isoleucine (Ile, I)
n = 23 (10.04%)
Methionine (Met, M)
n = 11 (4.8%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 16 (6.99%)
Glutamic acid (Glu, E)
n = 12 (5.24%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 6 (2.62%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 9 10 5 8 1 6 8 0 2 6 3 2 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 3 7 2 2 2 2 2 4 6 3 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 1 3 5 3 0 0 3 4 6 0 1 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 3 4 12 6 0 0 2 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 62 60 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 53 67 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 86 76 53
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 19 (7.31%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 8 6 10 5 14 3 0 7 1 3 7 4 0 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 2 9 11 0 2 8 10 1 3 6 2 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 11 2 2 5 6 0 0 3 3 8 0 0 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 2 3 2 1 1 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 75 56 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 68 54 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 99 93 54
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.84%)
Alanine (Ala, A)
n = 31 (8.16%)
Serine (Ser, S)
n = 19 (5.0%)
Threonine (Thr, T)
n = 24 (6.32%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 29 (7.63%)
Leucine (Leu, L)
n = 56 (14.74%)
Isoleucine (Ile, I)
n = 33 (8.68%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 23 (6.05%)
Phenylalanine (Phe, F)
n = 30 (7.89%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 12 (3.16%)
Aspartic acid (Asp, D)
n = 10 (2.63%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 26 5 13 17 13 1 12 5 1 7 12 9 1 5 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 5 16 8 2 5 10 8 3 5 9 8 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 0 4 5 6 2 2 0 4 10 4 0 6 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 1 9 9 1 0 0 7 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
101 92 98 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 95 78 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 172 114 75
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.25%)
Alanine (Ala, A)
n = 34 (10.49%)
Serine (Ser, S)
n = 23 (7.1%)
Threonine (Thr, T)
n = 27 (8.33%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.32%)
Leucine (Leu, L)
n = 60 (18.52%)
Isoleucine (Ile, I)
n = 26 (8.02%)
Methionine (Met, M)
n = 9 (2.78%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 19 (5.86%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 14 6 16 9 26 2 5 5 2 4 3 7 0 9 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 9 11 11 3 1 8 5 3 4 10 8 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 7 1 3 6 7 3 1 3 2 9 4 2 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 0 4 7 0 1 2 3 2 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 95 85 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 104 56 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 114 111 71
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (5.76%)
Alanine (Ala, A)
n = 41 (11.82%)
Serine (Ser, S)
n = 21 (6.05%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (1.15%)
Leucine (Leu, L)
n = 80 (23.05%)
Isoleucine (Ile, I)
n = 18 (5.19%)
Methionine (Met, M)
n = 16 (4.61%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 12 20 26 20 5 8 12 2 1 2 1 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 21 13 2 1 8 10 1 2 12 7 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 16 2 4 5 7 0 0 5 2 5 4 1 3 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 1 1 7 3 0 1 3 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 117 102 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 122 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 130 127 65
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (5.76%)
Alanine (Ala, A)
n = 41 (11.82%)
Serine (Ser, S)
n = 21 (6.05%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (1.15%)
Leucine (Leu, L)
n = 80 (23.05%)
Isoleucine (Ile, I)
n = 18 (5.19%)
Methionine (Met, M)
n = 16 (4.61%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 12 20 26 20 5 8 12 2 1 2 1 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 21 13 2 1 8 10 1 2 12 7 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 16 2 4 5 7 0 0 5 2 5 4 1 3 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 1 1 7 3 0 1 3 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 117 102 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 122 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 130 127 65
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.66%)
Alanine (Ala, A)
n = 39 (8.5%)
Serine (Ser, S)
n = 33 (7.19%)
Threonine (Thr, T)
n = 43 (9.37%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 14 (3.05%)
Leucine (Leu, L)
n = 96 (20.92%)
Isoleucine (Ile, I)
n = 37 (8.06%)
Methionine (Met, M)
n = 23 (5.01%)
Proline (Pro, P)
n = 25 (5.45%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 13 (2.83%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 9 (1.96%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 21 19 16 28 31 7 13 9 0 1 6 5 2 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 4 2 22 14 1 2 11 9 4 3 15 6 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 15 2 2 15 8 0 0 8 8 6 1 1 4 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 2 0 4 8 1 0 1 10 0 0 0 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 139 133 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 132 74 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 189 176 69
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 15 (15.31%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 3 2 6 10 0 3 3 0 0 0 1 0 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 4 6 5 0 2 1 1 1 0 1 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 0 0 2 1 5 1 0 3 0 1 1 2 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 2 0 0 0 1 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 29 18 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 33 13 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 37 37 18
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.74%)
Alanine (Ala, A)
n = 57 (9.31%)
Serine (Ser, S)
n = 44 (7.19%)
Threonine (Thr, T)
n = 60 (9.8%)
Cysteine (Cys, C)
n = 7 (1.14%)
Valine (Val, V)
n = 29 (4.74%)
Leucine (Leu, L)
n = 91 (14.87%)
Isoleucine (Ile, I)
n = 55 (8.99%)
Methionine (Met, M)
n = 27 (4.41%)
Proline (Pro, P)
n = 33 (5.39%)
Phenylalanine (Phe, F)
n = 44 (7.19%)
Tyrosine (Tyr, Y)
n = 13 (2.12%)
Tryptophan (Trp, W)
n = 12 (1.96%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 25 (4.08%)
Glutamine (Gln, Q)
n = 17 (2.78%)
Histidine (His, H)
n = 11 (1.8%)
Lysine (Lys, K)
n = 21 (3.43%)
Arginine (Arg, R)
n = 12 (1.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 32 24 12 23 32 8 13 15 2 8 10 8 3 15 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 5 10 27 19 1 4 8 15 2 7 16 8 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 20 3 7 11 11 1 1 13 1 12 4 3 7 18 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 2 5 8 19 2 0 4 8 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
140 148 202 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 180 113 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 254 210 112
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.14%)
Alanine (Ala, A)
n = 18 (10.4%)
Serine (Ser, S)
n = 16 (9.25%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 27 (15.61%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 10 (5.78%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 1 (0.58%)
Glutamic acid (Glu, E)
n = 7 (4.05%)
Asparagine (Asn, N)
n = 3 (1.73%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 2 3 2 1 3 9 0 0 7 2 3 15 10 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 7 2 6 3 3 3 3 12 3 1 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 9 2 0 0 3 2 7 1 3 9 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 6 1 0 0 0 1 0 1 3 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 20 24 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 38 21 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
62 17 31 64
Total protein-coding genes (size: 11439 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 233 (6.12%)
Alanine (Ala, A)
n = 356 (9.35%)
Serine (Ser, S)
n = 243 (6.38%)
Threonine (Thr, T)
n = 306 (8.03%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 207 (5.43%)
Leucine (Leu, L)
n = 650 (17.06%)
Isoleucine (Ile, I)
n = 282 (7.4%)
Methionine (Met, M)
n = 157 (4.12%)
Proline (Pro, P)
n = 226 (5.93%)
Phenylalanine (Phe, F)
n = 239 (6.27%)
Tyrosine (Tyr, Y)
n = 115 (3.02%)
Tryptophan (Trp, W)
n = 117 (3.07%)
Aspartic acid (Asp, D)
n = 78 (2.05%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 121 (3.18%)
Glutamine (Gln, Q)
n = 93 (2.44%)
Histidine (His, H)
n = 98 (2.57%)
Lysine (Lys, K)
n = 79 (2.07%)
Arginine (Arg, R)
n = 80 (2.1%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
136 146 111 150 159 187 41 92 78 15 46 65 66 30 92 147
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 6 20 68 153 118 17 34 79 77 43 46 99 68 13 64
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
116 114 12 45 71 60 9 7 51 41 74 24 21 36 85 15
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
83 75 22 22 56 70 9 5 18 49 8 0 0 4 3 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
971 1034 1003 802
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
514 1073 688 1535
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
313 1422 1262 813

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.