Viewing data for Amphiprion clarkii


Scientific name Amphiprion clarkii
Common name Black clown
Maximum lifespan 11.00 years (Amphiprion clarkii@AnAge)

Total mtDNA (size: 16976 bases) GC AT G C A T
Base content (bases) 7588 9388 4928 2660 4439 4949
Base content per 1 kb (bases) 447 553 290 157 261 292
Base content (%) 44.7% 55.3%
Total protein-coding genes (size: 11450 bases) GC AT G C A T
Base content (bases) 5181 6269 3573 1608 3100 3169
Base content per 1 kb (bases) 452 548 312 140 271 277
Base content (%) 45.2% 54.8%
D-loop (size: 1231 bases) GC AT G C A T
Base content (bases) 438 793 274 164 381 412
Base content per 1 kb (bases) 356 644 223 133 310 335
Base content (%) 35.6% 64.4%
Total tRNA-coding genes (size: 1555 bases) GC AT G C A T
Base content (bases) 706 849 392 314 375 474
Base content per 1 kb (bases) 454 546 252 202 241 305
Base content (%) 45.4% 54.6%
Total rRNA-coding genes (size: 2647 bases) GC AT G C A T
Base content (bases) 1215 1432 655 560 566 866
Base content per 1 kb (bases) 459 541 247 212 214 327
Base content (%) 45.9% 54.1%
12S rRNA gene (size: 950 bases) GC AT G C A T
Base content (bases) 457 493 242 215 198 295
Base content per 1 kb (bases) 481 519 255 226 208 311
Base content (%) 48.1% 51.9%
16S rRNA gene (size: 1697 bases) GC AT G C A T
Base content (bases) 758 939 413 345 368 571
Base content per 1 kb (bases) 447 553 243 203 217 336
Base content (%) 44.7% 55.3%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 298 385 212 86 196 189
Base content per 1 kb (bases) 436 564 310 126 287 277
Base content (%) 43.6% 56.4%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 53 19 45 51
Base content per 1 kb (bases) 429 571 315 113 268 304
Base content (%) 42.9% 57.1%
COX1 (size: 1566 bases) GC AT G C A T
Base content (bases) 709 857 424 285 472 385
Base content per 1 kb (bases) 453 547 271 182 301 246
Base content (%) 45.3% 54.7%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 302 389 196 106 189 200
Base content per 1 kb (bases) 437 563 284 153 274 289
Base content (%) 43.7% 56.3%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 376 409 251 125 207 202
Base content per 1 kb (bases) 479 521 320 159 264 257
Base content (%) 47.9% 52.1%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 513 628 355 158 325 303
Base content per 1 kb (bases) 450 550 311 138 285 266
Base content (%) 45.0% 55.0%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 446 529 314 132 263 266
Base content per 1 kb (bases) 457 543 322 135 270 273
Base content (%) 45.7% 54.3%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 478 567 358 120 264 303
Base content per 1 kb (bases) 457 543 343 115 253 290
Base content (%) 45.7% 54.3%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 164 185 115 49 105 80
Base content per 1 kb (bases) 470 530 330 140 301 229
Base content (%) 47.0% 53.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 638 743 446 192 372 371
Base content per 1 kb (bases) 462 538 323 139 269 269
Base content (%) 46.2% 53.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 145 152 104 41 83 69
Base content per 1 kb (bases) 488 512 350 138 279 232
Base content (%) 48.8% 51.2%
ND5 (size: 1869 bases) GC AT G C A T
Base content (bases) 814 1055 576 238 502 553
Base content per 1 kb (bases) 436 564 308 127 269 296
Base content (%) 43.6% 56.4%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 233 289 172 61 83 206
Base content per 1 kb (bases) 446 554 330 117 159 395
Base content (%) 44.6% 55.4%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 22 (9.73%)
Serine (Ser, S)
n = 9 (3.98%)
Threonine (Thr, T)
n = 20 (8.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.75%)
Leucine (Leu, L)
n = 49 (21.68%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 10 (4.42%)
Proline (Pro, P)
n = 17 (7.52%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 10 (4.42%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 7 7 9 13 17 2 8 10 0 2 3 7 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 10 7 5 0 2 2 3 3 5 7 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 0 1 2 1 0 1 4 1 2 0 0 3 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 0 1 1 1 0 1 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 77 67 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 63 33 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 72 88 56
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLVFLTVIPPKVLAHTFPNEPTHQSTEKPKTDPWTWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (7.27%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 3 (5.45%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 0 1 0 2 0 2 2 0 1 2 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 2 1 0 0 0 0 0 3 3 3 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 1 0 0 1 0 0 0 1 0 0 0 0 1 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 18 15 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 20 14 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 15 22 16
COX1 (size: 1566 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.02%)
Alanine (Ala, A)
n = 45 (8.64%)
Serine (Ser, S)
n = 28 (5.37%)
Threonine (Thr, T)
n = 39 (7.49%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 45 (8.64%)
Leucine (Leu, L)
n = 63 (12.09%)
Isoleucine (Ile, I)
n = 37 (7.1%)
Methionine (Met, M)
n = 23 (4.41%)
Proline (Pro, P)
n = 29 (5.57%)
Phenylalanine (Phe, F)
n = 42 (8.06%)
Tyrosine (Tyr, Y)
n = 19 (3.65%)
Tryptophan (Trp, W)
n = 18 (3.45%)
Aspartic acid (Asp, D)
n = 15 (2.88%)
Glutamic acid (Glu, E)
n = 11 (2.11%)
Asparagine (Asn, N)
n = 14 (2.69%)
Glutamine (Gln, Q)
n = 9 (1.73%)
Histidine (His, H)
n = 19 (3.65%)
Lysine (Lys, K)
n = 9 (1.73%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 15 13 20 12 13 9 8 5 4 18 6 16 5 17 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 11 20 13 1 6 13 21 7 7 8 13 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 11 3 8 8 7 1 0 4 10 9 1 1 6 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 10 1 7 8 9 0 2 1 5 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
163 119 126 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 97 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 168 162 148
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 18 (7.86%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 9 (3.93%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 16 (6.99%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 22 (9.61%)
Methionine (Met, M)
n = 11 (4.8%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 5 (2.18%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 11 8 10 5 9 0 5 7 1 3 3 7 3 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 5 11 2 0 1 4 4 0 4 5 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 4 6 3 0 1 3 3 6 1 0 2 2 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 14 1 1 12 5 0 1 1 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 61 55 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 53 64 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 82 81 58
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 7 6 5 12 11 0 4 9 0 1 8 7 0 6 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 3 12 8 0 4 10 6 2 3 4 5 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 3 4 3 0 1 2 3 9 0 0 1 0 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 0 0 5 2 0 1 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 70 53 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 67 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 114 94 47
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 31 (8.18%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 19 (5.01%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 25 (6.6%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 31 (8.18%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 32 (8.44%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 19 (5.01%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 15 6 10 17 24 2 7 7 0 7 5 13 0 9 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 2 21 8 0 1 11 11 1 5 5 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 0 4 12 5 1 1 1 6 8 1 0 3 16 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 1 0 11 9 0 1 0 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 101 91 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 93 78 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 161 134 74
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 30 (9.26%)
Serine (Ser, S)
n = 23 (7.1%)
Threonine (Thr, T)
n = 22 (6.79%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (4.94%)
Leucine (Leu, L)
n = 69 (21.3%)
Isoleucine (Ile, I)
n = 22 (6.79%)
Methionine (Met, M)
n = 11 (3.4%)
Proline (Pro, P)
n = 22 (6.79%)
Phenylalanine (Phe, F)
n = 21 (6.48%)
Tyrosine (Tyr, Y)
n = 10 (3.09%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 12 (3.7%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 8 9 14 16 25 4 10 7 0 1 5 10 0 5 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 14 13 0 2 9 5 2 5 10 6 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 0 0 9 9 1 0 4 2 8 0 0 4 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 2 1 3 7 0 0 0 6 2 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 99 77 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 93 55 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 122 134 55
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 39 (11.24%)
Serine (Ser, S)
n = 21 (6.05%)
Threonine (Thr, T)
n = 42 (12.1%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 75 (21.61%)
Isoleucine (Ile, I)
n = 23 (6.63%)
Methionine (Met, M)
n = 19 (5.48%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 6 15 19 19 25 5 7 14 1 0 2 5 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 7 17 15 0 1 10 7 0 8 8 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 18 0 1 11 6 0 2 1 0 7 2 0 1 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 2 8 1 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 116 106 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 121 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 121 143 71
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 39 (11.24%)
Serine (Ser, S)
n = 21 (6.05%)
Threonine (Thr, T)
n = 42 (12.1%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 75 (21.61%)
Isoleucine (Ile, I)
n = 23 (6.63%)
Methionine (Met, M)
n = 19 (5.48%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 6 15 19 19 25 5 7 14 1 0 2 5 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 7 17 15 0 1 10 7 0 8 8 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 18 0 1 11 6 0 2 1 0 7 2 0 1 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 2 8 1 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 116 106 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 121 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 121 143 71
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.66%)
Alanine (Ala, A)
n = 43 (9.37%)
Serine (Ser, S)
n = 31 (6.75%)
Threonine (Thr, T)
n = 44 (9.59%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 13 (2.83%)
Leucine (Leu, L)
n = 91 (19.83%)
Isoleucine (Ile, I)
n = 35 (7.63%)
Methionine (Met, M)
n = 28 (6.1%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 18 (3.92%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 13 (2.83%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 14 20 27 23 30 3 8 10 0 5 4 4 0 8 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 4 7 20 15 1 5 9 8 4 7 9 9 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 12 1 2 16 4 0 2 7 5 10 2 0 6 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 2 0 3 7 2 0 3 9 0 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 142 136 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 135 72 183
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 169 163 104
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 14 (14.29%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 3 4 5 9 2 2 2 0 0 1 0 0 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 8 5 0 1 3 1 0 2 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 0 3 2 4 0 1 0 0 0 0 1 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 0 2 0 0 0 2 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 32 19 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 34 15 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 38 35 22
ND5 (size: 1869 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (4.98%)
Alanine (Ala, A)
n = 54 (8.68%)
Serine (Ser, S)
n = 45 (7.23%)
Threonine (Thr, T)
n = 59 (9.49%)
Cysteine (Cys, C)
n = 7 (1.13%)
Valine (Val, V)
n = 26 (4.18%)
Leucine (Leu, L)
n = 99 (15.92%)
Isoleucine (Ile, I)
n = 47 (7.56%)
Methionine (Met, M)
n = 31 (4.98%)
Proline (Pro, P)
n = 31 (4.98%)
Phenylalanine (Phe, F)
n = 47 (7.56%)
Tyrosine (Tyr, Y)
n = 8 (1.29%)
Tryptophan (Trp, W)
n = 14 (2.25%)
Aspartic acid (Asp, D)
n = 16 (2.57%)
Glutamic acid (Glu, E)
n = 12 (1.93%)
Asparagine (Asn, N)
n = 33 (5.31%)
Glutamine (Gln, Q)
n = 16 (2.57%)
Histidine (His, H)
n = 13 (2.09%)
Lysine (Lys, K)
n = 24 (3.86%)
Arginine (Arg, R)
n = 9 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 26 24 18 18 43 5 13 15 1 6 7 11 2 15 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 5 12 25 16 1 4 15 9 3 7 14 9 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 21 2 6 20 8 1 2 8 4 4 1 2 5 28 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 1 8 8 24 0 1 0 8 0 1 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
139 153 205 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 179 122 250
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 244 226 126
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 20 (11.56%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 25 (14.45%)
Leucine (Leu, L)
n = 29 (16.76%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 1 3 0 0 2 16 0 0 9 2 5 9 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 6 1 6 7 4 1 9 11 5 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 0 4 1 2 0 7 1 2 8 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 5 2 0 0 0 1 0 2 2 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 16 15 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 38 19 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 7 49 64
Total protein-coding genes (size: 11472 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 241 (6.31%)
Alanine (Ala, A)
n = 350 (9.16%)
Serine (Ser, S)
n = 243 (6.36%)
Threonine (Thr, T)
n = 302 (7.91%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 211 (5.52%)
Leucine (Leu, L)
n = 651 (17.04%)
Isoleucine (Ile, I)
n = 269 (7.04%)
Methionine (Met, M)
n = 169 (4.42%)
Proline (Pro, P)
n = 218 (5.71%)
Phenylalanine (Phe, F)
n = 248 (6.49%)
Tyrosine (Tyr, Y)
n = 107 (2.8%)
Tryptophan (Trp, W)
n = 121 (3.17%)
Aspartic acid (Asp, D)
n = 79 (2.07%)
Glutamic acid (Glu, E)
n = 102 (2.67%)
Asparagine (Asn, N)
n = 119 (3.12%)
Glutamine (Gln, Q)
n = 98 (2.57%)
Histidine (His, H)
n = 105 (2.75%)
Lysine (Lys, K)
n = 80 (2.09%)
Arginine (Arg, R)
n = 75 (1.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
156 113 114 144 151 213 37 94 91 7 55 48 88 20 98 150
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
55 7 20 69 163 108 10 31 90 86 34 62 76 75 5 60
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
122 113 7 38 97 55 5 13 35 42 65 10 12 34 85 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
77 86 16 21 58 75 5 7 9 55 4 1 0 5 0 111
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
983 1041 988 809
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
513 1065 695 1548
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
227 1359 1370 865

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.