Viewing data for Anoplopoma fimbria


Scientific name Anoplopoma fimbria
Common name Sablefish
Maximum lifespan 114.00 years (Anoplopoma fimbria@AnAge)

Total mtDNA (size: 16507 bases) GC AT G C A T
Base content (bases) 7912 8595 4885 3027 4297 4298
Base content per 1 kb (bases) 479 521 296 183 260 260
Base content (%) 47.9% 52.1%
Total protein-coding genes (size: 11407 bases) GC AT G C A T
Base content (bases) 5589 5818 3622 1967 3098 2720
Base content per 1 kb (bases) 490 510 318 172 272 238
Base content (%) 49.0% 51.0%
D-loop (size: 909 bases) GC AT G C A T
Base content (bases) 354 555 205 149 261 294
Base content per 1 kb (bases) 389 611 226 164 287 323
Base content (%) 38.9% 61.1%
Total tRNA-coding genes (size: 1551 bases) GC AT G C A T
Base content (bases) 723 828 389 334 375 453
Base content per 1 kb (bases) 466 534 251 215 242 292
Base content (%) 46.6% 53.4%
Total rRNA-coding genes (size: 2639 bases) GC AT G C A T
Base content (bases) 1240 1399 668 572 560 839
Base content per 1 kb (bases) 470 530 253 217 212 318
Base content (%) 47.0% 53.0%
12S rRNA gene (size: 945 bases) GC AT G C A T
Base content (bases) 458 487 245 213 199 288
Base content per 1 kb (bases) 485 515 259 225 211 305
Base content (%) 48.5% 51.5%
16S rRNA gene (size: 1694 bases) GC AT G C A T
Base content (bases) 782 912 423 359 361 551
Base content per 1 kb (bases) 462 538 250 212 213 325
Base content (%) 46.2% 53.8%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 331 353 230 101 190 163
Base content per 1 kb (bases) 484 516 336 148 278 238
Base content (%) 48.4% 51.6%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 79 89 54 25 43 46
Base content per 1 kb (bases) 470 530 321 149 256 274
Base content (%) 47.0% 53.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 729 822 442 287 448 374
Base content per 1 kb (bases) 470 530 285 185 289 241
Base content (%) 47.0% 53.0%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 318 373 199 119 186 187
Base content per 1 kb (bases) 460 540 288 172 269 271
Base content (%) 46.0% 54.0%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 381 404 231 150 222 182
Base content per 1 kb (bases) 485 515 294 191 283 232
Base content (%) 48.5% 51.5%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 563 578 367 196 326 252
Base content per 1 kb (bases) 493 507 322 172 286 221
Base content (%) 49.3% 50.7%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 484 491 309 175 288 203
Base content per 1 kb (bases) 496 504 317 179 295 208
Base content (%) 49.6% 50.4%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 517 529 359 158 275 254
Base content per 1 kb (bases) 494 506 343 151 263 243
Base content (%) 49.4% 50.6%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 185 164 119 66 102 62
Base content per 1 kb (bases) 530 470 341 189 292 178
Base content (%) 53.0% 47.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 712 669 466 246 357 312
Base content per 1 kb (bases) 516 484 337 178 259 226
Base content (%) 51.6% 48.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 151 146 100 51 85 61
Base content per 1 kb (bases) 508 492 337 172 286 205
Base content (%) 50.8% 49.2%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 869 970 575 294 511 459
Base content per 1 kb (bases) 473 527 313 160 278 250
Base content (%) 47.3% 52.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 274 248 173 101 72 176
Base content per 1 kb (bases) 525 475 331 193 138 337
Base content (%) 52.5% 47.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.29%)
Alanine (Ala, A)
n = 20 (8.81%)
Serine (Ser, S)
n = 10 (4.41%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 52 (22.91%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 1 16 8 17 6 4 5 3 1 3 4 2 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 3 11 6 0 3 2 4 3 3 11 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 2 2 3 1 0 1 3 2 2 1 1 3 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 2 0 1 1 0 1 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 82 66 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 66 32 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 82 65 54
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWLAILVFSWLVFLVVIPPKVIAHTFPNEPTLQSAEKPKADSWTWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (9.09%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 0 1 1 2 1 1 1 1 3 0 2 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 2 2 0 0 0 0 0 1 6 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 1 0 1 0 0 1 0 1 0 0 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 1 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
13 18 13 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 19 13 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 17 20 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 50 (9.69%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 35 (6.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.95%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 29 (5.62%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 18 8 18 16 16 5 6 6 2 10 7 23 1 18 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
14 0 1 8 20 21 1 8 16 9 14 10 12 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 2 8 9 6 0 1 4 6 12 2 2 4 11 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 2 5 9 7 1 1 2 5 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
163 119 125 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 186 155 130
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 19 (8.3%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 8 (3.49%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 19 (8.3%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 21 (9.17%)
Methionine (Met, M)
n = 10 (4.37%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 9 (3.93%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 7 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 7 6 7 9 7 3 1 6 2 4 8 7 0 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 2 8 9 0 0 4 4 1 4 7 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 1 5 5 1 1 3 3 6 2 2 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 1 6 7 4 0 3 3 1 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 64 52 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 53 62 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 82 73 57
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (8.85%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 4 4 12 4 8 2 3 5 3 3 7 7 1 7 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 9 8 1 4 7 8 4 7 5 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 2 2 5 3 0 2 2 6 6 3 2 0 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 3 1 4 2 0 0 1 3 2 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 69 49 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 67 54 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 95 78 62
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 33 (8.71%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 19 (5.01%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 23 (6.07%)
Leucine (Leu, L)
n = 65 (17.15%)
Isoleucine (Ile, I)
n = 28 (7.39%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 20 (5.28%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 13 3 11 28 10 9 6 4 2 6 8 5 4 11 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 5 10 13 5 6 11 6 4 4 12 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 0 5 5 7 10 2 0 2 6 9 1 1 4 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 2 4 6 6 3 0 1 5 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 105 86 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 97 78 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 165 88 82
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 36 (11.11%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 18 (5.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (5.56%)
Leucine (Leu, L)
n = 66 (20.37%)
Isoleucine (Ile, I)
n = 24 (7.41%)
Methionine (Met, M)
n = 9 (2.78%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 19 (5.86%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 6 5 17 15 17 10 3 3 4 6 6 4 2 10 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 20 7 4 1 8 2 7 8 12 3 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 4 2 5 6 3 3 1 3 4 7 2 4 4 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 2 2 6 1 2 1 3 2 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 102 73 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 95 56 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 112 74 89
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (5.76%)
Alanine (Ala, A)
n = 39 (11.24%)
Serine (Ser, S)
n = 26 (7.49%)
Threonine (Thr, T)
n = 41 (11.82%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.32%)
Leucine (Leu, L)
n = 76 (21.9%)
Isoleucine (Ile, I)
n = 16 (4.61%)
Methionine (Met, M)
n = 11 (3.17%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 10 (2.88%)
Lysine (Lys, K)
n = 7 (2.02%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 8 6 22 19 14 7 10 11 3 4 4 6 1 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 5 18 13 3 3 8 6 3 3 10 5 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 12 3 5 10 5 2 1 3 1 6 1 4 4 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 1 1 2 5 2 1 1 1 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 110 90 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 122 56 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 127 107 76
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (5.76%)
Alanine (Ala, A)
n = 39 (11.24%)
Serine (Ser, S)
n = 26 (7.49%)
Threonine (Thr, T)
n = 41 (11.82%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.32%)
Leucine (Leu, L)
n = 76 (21.9%)
Isoleucine (Ile, I)
n = 16 (4.61%)
Methionine (Met, M)
n = 11 (3.17%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 10 (2.88%)
Lysine (Lys, K)
n = 7 (2.02%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 8 6 22 19 14 7 10 11 3 4 4 6 1 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 5 18 13 3 3 8 6 3 3 10 5 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 12 3 5 10 5 2 1 3 1 6 1 4 4 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 1 1 2 5 2 1 1 1 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 110 90 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 122 56 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 127 107 76
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (6.1%)
Alanine (Ala, A)
n = 36 (7.84%)
Serine (Ser, S)
n = 30 (6.54%)
Threonine (Thr, T)
n = 41 (8.93%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 28 (6.1%)
Leucine (Leu, L)
n = 97 (21.13%)
Isoleucine (Ile, I)
n = 28 (6.1%)
Methionine (Met, M)
n = 23 (5.01%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 6 (1.31%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 19 11 25 36 18 11 6 6 4 9 5 11 3 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 2 3 2 20 12 2 2 13 4 9 6 16 4 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 9 3 5 9 4 2 2 8 5 8 8 1 4 7 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 5 1 5 8 2 1 4 7 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 150 123 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 124 72 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
63 192 117 88
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 15 (15.31%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 1 2 3 7 6 2 5 3 0 0 1 1 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 9 4 1 3 0 3 0 1 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 2 3 2 1 1 2 0 0 0 1 0 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 1 1 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
26 30 17 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 32 12 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 38 32 20
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.39%)
Alanine (Ala, A)
n = 54 (8.82%)
Serine (Ser, S)
n = 48 (7.84%)
Threonine (Thr, T)
n = 61 (9.97%)
Cysteine (Cys, C)
n = 7 (1.14%)
Valine (Val, V)
n = 35 (5.72%)
Leucine (Leu, L)
n = 98 (16.01%)
Isoleucine (Ile, I)
n = 41 (6.7%)
Methionine (Met, M)
n = 25 (4.08%)
Proline (Pro, P)
n = 31 (5.07%)
Phenylalanine (Phe, F)
n = 40 (6.54%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 25 (4.08%)
Glutamine (Gln, Q)
n = 18 (2.94%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 19 (3.1%)
Arginine (Arg, R)
n = 11 (1.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 20 8 25 25 23 13 11 14 4 15 11 6 3 27 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
17 3 4 11 27 14 2 6 15 4 8 5 17 7 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 20 6 10 11 11 2 1 13 3 9 3 1 6 19 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 4 4 8 16 3 2 3 5 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 162 185 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 180 115 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
69 233 159 152
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 16 (9.25%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 22 (12.72%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 5 (2.89%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 7 (4.05%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 0 6 5 3 2 9 0 0 8 0 5 9 6 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 8 2 3 4 3 3 3 16 2 3 0 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 4 5 1 1 3 2 5 3 4 6 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 4 0 3 0 0 0 0 1 3 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 28 23 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 39 19 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
60 34 30 50
Total protein-coding genes (size: 11429 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 254 (6.67%)
Alanine (Ala, A)
n = 356 (9.35%)
Serine (Ser, S)
n = 255 (6.7%)
Threonine (Thr, T)
n = 292 (7.67%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 241 (6.33%)
Leucine (Leu, L)
n = 666 (17.5%)
Isoleucine (Ile, I)
n = 247 (6.49%)
Methionine (Met, M)
n = 139 (3.65%)
Proline (Pro, P)
n = 222 (5.83%)
Phenylalanine (Phe, F)
n = 230 (6.04%)
Tyrosine (Tyr, Y)
n = 111 (2.92%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 77 (2.02%)
Glutamic acid (Glu, E)
n = 98 (2.57%)
Asparagine (Asn, N)
n = 113 (2.97%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 109 (2.86%)
Lysine (Lys, K)
n = 71 (1.87%)
Arginine (Arg, R)
n = 79 (2.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
137 110 54 170 179 145 78 67 67 28 71 61 82 27 109 121
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
85 8 17 54 166 112 24 39 91 54 70 57 116 39 10 45
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
128 92 27 51 76 52 16 14 46 42 69 28 27 30 83 33
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 67 31 26 51 57 14 12 20 35 12 0 0 7 0 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1026 1077 922 782
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
538 1065 681 1523
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
477 1410 1022 898

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.