Viewing data for Sardina pilchardus


Scientific name Sardina pilchardus
Common name European pilchard
Maximum lifespan 15.00 years (Sardina pilchardus@AnAge)

Total mtDNA (size: 16822 bases) GC AT G C A T
Base content (bases) 8421 8399 4767 3654 4334 4065
Base content per 1 kb (bases) 501 499 283 217 258 242
Base content (%) 50.1% 49.9%
Total protein-coding genes (size: 11489 bases) GC AT G C A T
Base content (bases) 5797 5692 3385 2412 3137 2555
Base content per 1 kb (bases) 505 495 295 210 273 222
Base content (%) 50.5% 49.5%
D-loop (size: 896 bases) GC AT G C A T
Base content (bases) 410 484 224 186 244 240
Base content per 1 kb (bases) 458 540 250 208 272 268
Base content (%) 45.8% 54.0%
Total tRNA-coding genes (size: 1550 bases) GC AT G C A T
Base content (bases) 767 783 404 363 366 417
Base content per 1 kb (bases) 495 505 261 234 236 269
Base content (%) 49.5% 50.5%
Total rRNA-coding genes (size: 2635 bases) GC AT G C A T
Base content (bases) 1317 1318 691 626 530 788
Base content per 1 kb (bases) 500 500 262 238 201 299
Base content (%) 50.0% 50.0%
12S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 480 473 251 229 201 272
Base content per 1 kb (bases) 504 496 263 240 211 285
Base content (%) 50.4% 49.6%
16S rRNA gene (size: 1682 bases) GC AT G C A T
Base content (bases) 837 845 440 397 329 516
Base content per 1 kb (bases) 498 502 262 236 196 307
Base content (%) 49.8% 50.2%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 334 349 211 123 196 153
Base content per 1 kb (bases) 489 511 309 180 287 224
Base content (%) 48.9% 51.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 79 89 51 28 40 49
Base content per 1 kb (bases) 470 530 304 167 238 292
Base content (%) 47.0% 53.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 758 793 409 349 455 338
Base content per 1 kb (bases) 489 511 264 225 293 218
Base content (%) 48.9% 51.1%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 323 368 193 130 191 177
Base content per 1 kb (bases) 467 533 279 188 276 256
Base content (%) 46.7% 53.3%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 410 375 236 174 206 169
Base content per 1 kb (bases) 522 478 301 222 262 215
Base content (%) 52.2% 47.8%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 580 561 337 243 320 241
Base content per 1 kb (bases) 508 492 295 213 280 211
Base content (%) 50.8% 49.2%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 514 461 299 215 285 176
Base content per 1 kb (bases) 527 473 307 221 292 181
Base content (%) 52.7% 47.3%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 564 482 360 204 264 218
Base content per 1 kb (bases) 539 461 344 195 252 208
Base content (%) 53.9% 46.1%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 172 177 101 71 106 71
Base content per 1 kb (bases) 493 507 289 203 304 203
Base content (%) 49.3% 50.7%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 700 681 388 312 383 298
Base content per 1 kb (bases) 507 493 281 226 277 216
Base content (%) 50.7% 49.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 163 134 101 62 82 52
Base content per 1 kb (bases) 549 451 340 209 276 175
Base content (%) 54.9% 45.1%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 903 936 535 368 505 431
Base content per 1 kb (bases) 491 509 291 200 275 234
Base content (%) 49.1% 50.9%
ND6 (size: 600 bases) GC AT G C A T
Base content (bases) 300 300 165 135 110 190
Base content per 1 kb (bases) 500 500 275 225 183 317
Base content (%) 50.0% 50.0%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 21 (9.29%)
Serine (Ser, S)
n = 6 (2.65%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.64%)
Leucine (Leu, L)
n = 50 (22.12%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 10 (4.42%)
Proline (Pro, P)
n = 17 (7.52%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 8 5 18 10 11 6 4 5 4 4 5 2 4 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 5 8 6 2 0 3 1 7 0 8 3 6 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 7 3 1 1 0 0 1 3 3 2 4 1 3 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 1 0 0 1 0 0 5 1 0 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 80 67 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 62 32 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 69 53 60
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLIFLTVIPPKVLAHNFNNEPTVAGVEKAKPESWNWAWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 6 (10.91%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 2 (3.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (9.09%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 0 0 0 3 0 0 1 0 2 2 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 4 1 1 1 0 0 0 1 2 3 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 0 2 0 0 0 0 0 1 1 2 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 1 0 0 3 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
15 12 14 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 17 15 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 22 20 7
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 29 (5.62%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.14%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 19 1 21 10 13 12 2 4 4 11 6 10 15 23 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
23 0 1 10 18 14 4 6 13 12 16 10 9 7 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 17 5 3 6 12 4 1 3 5 12 7 5 6 9 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 2 9 7 8 6 3 1 0 5 2 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
161 120 126 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 135 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
111 154 116 136
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 18 (7.86%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 18 (7.86%)
Leucine (Leu, L)
n = 30 (13.1%)
Isoleucine (Ile, I)
n = 21 (9.17%)
Methionine (Met, M)
n = 11 (4.8%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 7 (3.06%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 15 (6.55%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 7 (3.06%)
Histidine (His, H)
n = 9 (3.93%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 8 4 12 3 6 3 3 6 1 6 4 5 3 6 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 2 1 10 6 1 2 3 3 1 3 2 6 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 1 3 9 2 0 1 2 2 7 0 3 2 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 5 4 11 1 3 0 3 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 60 53 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 56 62 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 77 62 60
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (8.85%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 20 (7.69%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 11 (4.23%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 5 3 4 7 7 12 3 4 4 2 7 9 2 11 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 2 11 6 2 4 5 9 5 3 4 3 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 6 3 1 1 5 4 0 3 3 8 4 0 1 0 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 3 6 2 3 0 2 0 1 2 2 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 71 48 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 69 52 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 96 68 46
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 34 (8.97%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 21 (5.54%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 30 (7.92%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 26 (6.86%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 5 (1.32%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 12 2 13 13 9 10 3 2 3 7 14 3 6 6 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 3 0 1 17 9 7 3 5 8 12 3 6 8 4 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 4 4 6 5 6 5 1 1 5 10 2 8 4 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 2 4 2 10 6 4 1 0 6 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
110 91 86 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 98 76 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
79 148 79 74
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (6.48%)
Alanine (Ala, A)
n = 36 (11.11%)
Serine (Ser, S)
n = 22 (6.79%)
Threonine (Thr, T)
n = 16 (4.94%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 29 (8.95%)
Leucine (Leu, L)
n = 57 (17.59%)
Isoleucine (Ile, I)
n = 18 (5.56%)
Methionine (Met, M)
n = 10 (3.09%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 22 (6.79%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 10 (3.09%)
Asparagine (Asn, N)
n = 10 (3.09%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 5 16 11 9 15 3 1 5 11 8 5 5 11 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 5 18 9 4 2 6 2 11 3 14 6 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 4 0 5 8 3 3 0 3 4 7 3 3 6 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 9 2 2 0 7 0 0 5 3 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 93 64 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 95 53 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 111 59 81
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 46 (13.26%)
Serine (Ser, S)
n = 27 (7.78%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 19 (5.48%)
Leucine (Leu, L)
n = 64 (18.44%)
Isoleucine (Ile, I)
n = 19 (5.48%)
Methionine (Met, M)
n = 14 (4.03%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 5 (1.44%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 8 5 16 19 12 11 3 10 5 6 4 2 7 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 2 0 7 25 8 6 3 8 3 3 6 11 0 2 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 6 8 4 7 6 2 0 8 1 7 6 3 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 5 0 2 4 4 1 0 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 102 97 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 127 51 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
71 131 69 77
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 46 (13.26%)
Serine (Ser, S)
n = 27 (7.78%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 19 (5.48%)
Leucine (Leu, L)
n = 64 (18.44%)
Isoleucine (Ile, I)
n = 19 (5.48%)
Methionine (Met, M)
n = 14 (4.03%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 5 (1.44%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 8 5 16 19 12 11 3 10 5 6 4 2 7 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 2 0 7 25 8 6 3 8 3 3 6 11 0 2 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 6 8 4 7 6 2 0 8 1 7 6 3 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 5 0 2 4 4 1 0 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 102 97 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 127 51 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
71 131 69 77
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (6.97%)
Alanine (Ala, A)
n = 40 (8.71%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 38 (8.28%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 28 (6.1%)
Leucine (Leu, L)
n = 81 (17.65%)
Isoleucine (Ile, I)
n = 36 (7.84%)
Methionine (Met, M)
n = 25 (5.45%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 18 (3.92%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 10 (2.18%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 19 8 17 15 14 15 11 4 7 9 7 6 6 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
17 1 4 7 18 9 6 4 7 6 15 10 8 6 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 12 8 7 4 4 5 0 8 5 9 9 9 3 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 7 1 3 3 7 0 2 2 7 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
115 121 127 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 125 71 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
121 142 100 97
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 10 (10.2%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 1 2 5 7 4 3 1 3 0 0 0 3 2 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 2 2 6 1 4 1 1 1 1 0 1 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 0 3 2 2 2 1 1 3 0 0 1 0 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 0 3 0 1 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
26 31 18 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 29 14 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 41 20 17
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.56%)
Alanine (Ala, A)
n = 60 (9.8%)
Serine (Ser, S)
n = 48 (7.84%)
Threonine (Thr, T)
n = 56 (9.15%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 38 (6.21%)
Leucine (Leu, L)
n = 88 (14.38%)
Isoleucine (Ile, I)
n = 51 (8.33%)
Methionine (Met, M)
n = 27 (4.41%)
Proline (Pro, P)
n = 29 (4.74%)
Phenylalanine (Phe, F)
n = 39 (6.37%)
Tyrosine (Tyr, Y)
n = 11 (1.8%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 11 (1.8%)
Asparagine (Asn, N)
n = 23 (3.76%)
Glutamine (Gln, Q)
n = 21 (3.43%)
Histidine (His, H)
n = 13 (2.12%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 25 7 19 17 22 14 10 9 12 9 10 9 10 23 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
20 3 3 11 28 11 10 2 11 5 16 4 12 9 4 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 9 10 9 13 10 3 4 9 3 8 5 6 5 18 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 2 9 5 8 10 10 0 0 6 4 0 1 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
156 145 191 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 180 112 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
134 210 128 141
ND6 (size: 600 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (10.05%)
Alanine (Ala, A)
n = 21 (10.55%)
Serine (Ser, S)
n = 14 (7.04%)
Threonine (Thr, T)
n = 2 (1.01%)
Cysteine (Cys, C)
n = 7 (3.52%)
Valine (Val, V)
n = 23 (11.56%)
Leucine (Leu, L)
n = 31 (15.58%)
Isoleucine (Ile, I)
n = 8 (4.02%)
Methionine (Met, M)
n = 9 (4.52%)
Proline (Pro, P)
n = 10 (5.03%)
Phenylalanine (Phe, F)
n = 12 (6.03%)
Tyrosine (Tyr, Y)
n = 4 (2.01%)
Tryptophan (Trp, W)
n = 4 (2.01%)
Aspartic acid (Asp, D)
n = 7 (3.52%)
Glutamic acid (Glu, E)
n = 8 (4.02%)
Asparagine (Asn, N)
n = 3 (1.51%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 3 (1.51%)
Lysine (Lys, K)
n = 8 (4.02%)
Arginine (Arg, R)
n = 5 (2.51%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 5 5 8 6 2 5 3 0 0 3 7 5 8 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 4 9 5 4 3 5 5 4 6 3 2 3 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 6 2 1 0 3 2 1 3 1 7 2 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 5 3 5 2 3 5 2 1 1 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 39 35 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 42 34 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 54 41 60
Total protein-coding genes (size: 11506 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 252 (6.58%)
Alanine (Ala, A)
n = 373 (9.74%)
Serine (Ser, S)
n = 248 (6.47%)
Threonine (Thr, T)
n = 284 (7.41%)
Cysteine (Cys, C)
n = 34 (0.89%)
Valine (Val, V)
n = 281 (7.33%)
Leucine (Leu, L)
n = 603 (15.74%)
Isoleucine (Ile, I)
n = 262 (6.84%)
Methionine (Met, M)
n = 157 (4.1%)
Proline (Pro, P)
n = 218 (5.69%)
Phenylalanine (Phe, F)
n = 238 (6.21%)
Tyrosine (Tyr, Y)
n = 109 (2.85%)
Tryptophan (Trp, W)
n = 120 (3.13%)
Aspartic acid (Asp, D)
n = 82 (2.14%)
Glutamic acid (Glu, E)
n = 103 (2.69%)
Asparagine (Asn, N)
n = 103 (2.69%)
Glutamine (Gln, Q)
n = 97 (2.53%)
Histidine (His, H)
n = 103 (2.69%)
Lysine (Lys, K)
n = 83 (2.17%)
Arginine (Arg, R)
n = 76 (1.98%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
136 126 49 154 122 117 111 50 50 47 73 75 62 71 117 121
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
108 14 20 60 175 87 51 35 67 55 95 48 84 55 31 53
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
113 73 45 48 63 52 27 12 46 34 75 45 49 34 69 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 39 64 29 53 37 46 6 8 41 21 0 1 5 0 75
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1091 998 948 795
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
541 1065 685 1541
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
812 1293 847 880

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.