Viewing data for Clupea harengus


Scientific name Clupea harengus
Common name Atlantic herring
Maximum lifespan 22.00 years (Clupea harengus@AnAge)

Total mtDNA (size: 16701 bases) GC AT G C A T
Base content (bases) 7913 8788 4714 3199 4290 4498
Base content per 1 kb (bases) 474 526 282 192 257 269
Base content (%) 47.4% 52.6%
Total protein-coding genes (size: 11405 bases) GC AT G C A T
Base content (bases) 5450 5955 3357 2093 3085 2870
Base content per 1 kb (bases) 478 522 294 184 270 252
Base content (%) 47.8% 52.2%
D-loop (size: 1047 bases) GC AT G C A T
Base content (bases) 400 647 227 173 327 320
Base content per 1 kb (bases) 382 618 217 165 312 306
Base content (%) 38.2% 61.8%
Total tRNA-coding genes (size: 1553 bases) GC AT G C A T
Base content (bases) 758 795 413 345 358 437
Base content per 1 kb (bases) 488 512 266 222 231 281
Base content (%) 48.8% 51.2%
Total rRNA-coding genes (size: 2636 bases) GC AT G C A T
Base content (bases) 1271 1365 694 577 510 855
Base content per 1 kb (bases) 482 518 263 219 193 324
Base content (%) 48.2% 51.8%
12S rRNA gene (size: 952 bases) GC AT G C A T
Base content (bases) 477 475 260 217 186 289
Base content per 1 kb (bases) 501 499 273 228 195 304
Base content (%) 50.1% 49.9%
16S rRNA gene (size: 1684 bases) GC AT G C A T
Base content (bases) 794 890 434 360 324 566
Base content per 1 kb (bases) 471 529 258 214 192 336
Base content (%) 47.1% 52.9%

ATP6 (size: 685 bases) GC AT G C A T
Base content (bases) 315 370 212 103 199 171
Base content per 1 kb (bases) 460 540 309 150 291 250
Base content (%) 46.0% 54.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 49 23 45 51
Base content per 1 kb (bases) 429 571 292 137 268 304
Base content (%) 42.9% 57.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 715 836 413 302 444 392
Base content per 1 kb (bases) 461 539 266 195 286 253
Base content (%) 46.1% 53.9%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 312 379 186 126 185 194
Base content per 1 kb (bases) 452 548 269 182 268 281
Base content (%) 45.2% 54.8%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 384 401 235 149 212 189
Base content per 1 kb (bases) 489 511 299 190 270 241
Base content (%) 48.9% 51.1%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 532 609 322 210 329 280
Base content per 1 kb (bases) 466 534 282 184 288 245
Base content (%) 46.6% 53.4%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 481 494 287 194 284 210
Base content per 1 kb (bases) 493 507 294 199 291 215
Base content (%) 49.3% 50.7%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 526 519 344 182 269 250
Base content per 1 kb (bases) 503 497 329 174 257 239
Base content (%) 50.3% 49.7%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 167 182 98 69 106 76
Base content per 1 kb (bases) 479 521 281 198 304 218
Base content (%) 47.9% 52.1%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 685 696 421 264 359 337
Base content per 1 kb (bases) 496 504 305 191 260 244
Base content (%) 49.6% 50.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 144 153 95 49 81 72
Base content per 1 kb (bases) 485 515 320 165 273 242
Base content (%) 48.5% 51.5%
ND5 (size: 1836 bases) GC AT G C A T
Base content (bases) 856 980 530 326 498 482
Base content per 1 kb (bases) 466 534 289 178 271 263
Base content (%) 46.6% 53.4%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 267 255 168 99 80 175
Base content per 1 kb (bases) 511 489 322 190 153 335
Base content (%) 51.1% 48.9%

ATP6 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 8 (3.52%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 52 (22.91%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 18 (7.93%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 7 (3.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 6 3 16 9 16 4 5 6 3 6 4 4 1 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 0 2 6 10 1 2 4 2 3 3 8 5 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 7 0 0 0 3 0 0 5 1 4 0 2 4 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 0 1 2 0 1 2 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 82 64 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 62 31 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 68 75 60
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWVVFLTIIPQKILAHNFNNEPTTMGAEKAKPEPWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 0 1 0 0 1 2 2 0 1 1 1 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 4 1 0 0 0 0 1 3 4 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 1 0 0 0 0 0 0 1 0 0 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 1 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
12 13 17 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 17 16 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 19 18 14
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 30 (5.81%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.95%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 13 5 19 6 30 5 2 7 1 12 5 17 7 14 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
19 0 1 6 20 18 3 5 3 22 16 9 9 8 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 12 3 3 8 12 2 1 4 4 14 1 1 8 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 3 5 9 7 2 2 0 5 1 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
159 123 128 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
66 154 170 127
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 15 (6.55%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 9 (3.93%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 23 (10.04%)
Leucine (Leu, L)
n = 30 (13.1%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 7 (3.06%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 6 7 7 8 2 3 7 1 4 7 10 2 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 2 6 5 2 1 0 5 3 4 3 4 3 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 5 5 4 0 0 3 4 5 1 3 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 3 4 9 4 0 0 2 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 62 51 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 52 63 90
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 72 80 51
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 20 (7.69%)
Leucine (Leu, L)
n = 30 (11.54%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 6 2 6 3 11 4 4 4 4 5 4 11 0 9 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 1 12 11 0 3 5 10 4 4 5 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 6 1 2 4 4 2 0 3 4 8 1 2 0 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 2 3 2 2 0 0 2 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 65 47 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 71 53 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 99 88 49
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 37 (9.76%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 27 (7.12%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 25 (6.6%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 9 6 12 11 15 10 10 5 1 7 7 8 5 9 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 8 12 16 1 1 1 13 12 3 7 5 6 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 2 4 7 10 2 0 2 3 11 1 1 3 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 1 5 5 4 5 0 0 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 95 85 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 101 74 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 126 121 81
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.25%)
Alanine (Ala, A)
n = 37 (11.42%)
Serine (Ser, S)
n = 23 (7.1%)
Threonine (Thr, T)
n = 22 (6.79%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 17 (5.25%)
Leucine (Leu, L)
n = 60 (18.52%)
Isoleucine (Ile, I)
n = 19 (5.86%)
Methionine (Met, M)
n = 15 (4.63%)
Proline (Pro, P)
n = 23 (7.1%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 10 (3.09%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 4 3 14 7 17 11 9 2 4 2 7 4 4 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 1 10 10 9 8 5 3 1 8 4 13 3 3 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 5 2 6 7 2 4 1 3 5 6 1 2 5 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 4 1 3 5 2 0 0 4 4 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 91 77 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 101 55 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
70 95 78 82
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 42 (12.1%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 3 (0.86%)
Valine (Val, V)
n = 14 (4.03%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 20 (5.76%)
Methionine (Met, M)
n = 18 (5.19%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 7 8 12 15 15 14 7 6 7 5 4 4 1 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 2 4 20 16 2 0 3 4 9 6 9 5 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 8 7 7 7 2 2 0 5 2 7 1 3 4 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 2 2 0 4 4 3 0 1 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 101 107 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 128 51 129
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
64 115 92 77
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 42 (12.1%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 3 (0.86%)
Valine (Val, V)
n = 14 (4.03%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 20 (5.76%)
Methionine (Met, M)
n = 18 (5.19%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 7 8 12 15 15 14 7 6 7 5 4 4 1 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 2 4 20 16 2 0 3 4 9 6 9 5 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 8 7 7 7 2 2 0 5 2 7 1 3 4 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 2 2 0 4 4 3 0 1 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 101 107 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 128 51 129
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
64 115 92 77
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (6.1%)
Alanine (Ala, A)
n = 43 (9.37%)
Serine (Ser, S)
n = 26 (5.66%)
Threonine (Thr, T)
n = 41 (8.93%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 19 (4.14%)
Leucine (Leu, L)
n = 87 (18.95%)
Isoleucine (Ile, I)
n = 38 (8.28%)
Methionine (Met, M)
n = 24 (5.23%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 9 (1.96%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 14 17 16 29 13 5 2 7 3 6 6 4 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 4 7 20 14 2 3 5 10 10 7 14 4 3 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 14 4 3 8 3 4 1 7 3 10 9 7 3 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 8 2 2 8 2 1 2 7 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 135 134 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 130 72 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
85 156 131 88
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 6 (6.12%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 5 (5.1%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 4 2 7 8 1 2 5 0 1 1 2 1 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 3 5 2 2 0 4 1 0 0 0 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 1 1 3 0 0 1 1 0 0 1 2 2 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 1 0 0 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 31 23 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 29 16 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 35 33 20
ND5 (size: 1836 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.24%)
Alanine (Ala, A)
n = 59 (9.66%)
Serine (Ser, S)
n = 43 (7.04%)
Threonine (Thr, T)
n = 60 (9.82%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 33 (5.4%)
Leucine (Leu, L)
n = 85 (13.91%)
Isoleucine (Ile, I)
n = 51 (8.35%)
Methionine (Met, M)
n = 31 (5.07%)
Proline (Pro, P)
n = 29 (4.75%)
Phenylalanine (Phe, F)
n = 39 (6.38%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 13 (2.13%)
Glutamic acid (Glu, E)
n = 10 (1.64%)
Asparagine (Asn, N)
n = 30 (4.91%)
Glutamine (Gln, Q)
n = 20 (3.27%)
Histidine (His, H)
n = 14 (2.29%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 23 15 14 15 28 16 10 11 9 10 11 7 5 20 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
16 2 4 9 23 20 7 7 9 6 10 8 14 5 2 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 12 10 5 10 13 2 4 9 6 6 4 2 10 20 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 5 5 8 7 13 0 0 8 2 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 146 205 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 178 120 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
104 206 157 145
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.14%)
Alanine (Ala, A)
n = 22 (12.72%)
Serine (Ser, S)
n = 7 (4.05%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 4 (2.31%)
Valine (Val, V)
n = 26 (15.03%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 17 (9.83%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 3 (1.73%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 2 (1.16%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 1 1 1 5 7 10 1 0 6 4 7 9 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 1 8 6 6 2 4 2 1 14 4 2 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 5 2 0 0 1 1 3 4 4 0 4 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 3 1 2 0 2 0 1 2 1 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 26 22 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 36 21 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 37 37 44
Total protein-coding genes (size: 11426 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 241 (6.33%)
Alanine (Ala, A)
n = 372 (9.78%)
Serine (Ser, S)
n = 230 (6.04%)
Threonine (Thr, T)
n = 302 (7.94%)
Cysteine (Cys, C)
n = 31 (0.81%)
Valine (Val, V)
n = 253 (6.65%)
Leucine (Leu, L)
n = 611 (16.06%)
Isoleucine (Ile, I)
n = 256 (6.73%)
Methionine (Met, M)
n = 172 (4.52%)
Proline (Pro, P)
n = 219 (5.76%)
Phenylalanine (Phe, F)
n = 239 (6.28%)
Tyrosine (Tyr, Y)
n = 115 (3.02%)
Tryptophan (Trp, W)
n = 118 (3.1%)
Aspartic acid (Asp, D)
n = 73 (1.92%)
Glutamic acid (Glu, E)
n = 96 (2.52%)
Asparagine (Asn, N)
n = 118 (3.1%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 101 (2.65%)
Lysine (Lys, K)
n = 77 (2.02%)
Arginine (Arg, R)
n = 78 (2.05%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
160 96 69 126 101 189 91 71 60 38 64 62 84 43 99 140
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
103 11 20 61 150 131 30 32 42 77 90 56 93 46 24 66
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
120 80 36 40 62 54 19 9 46 38 77 20 33 44 74 19
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
82 61 35 28 45 47 30 8 10 48 12 0 0 3 3 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1035 1003 980 788
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
523 1068 684 1531
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
607 1220 1118 861

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.