Viewing data for Hemignathus parvus


Scientific name Hemignathus parvus
Common name Anianiau
Maximum lifespan 9.50 years (Hemignathus parvus@AnAge)

Total mtDNA (size: 16833 bases) GC AT G C A T
Base content (bases) 7722 9110 5292 2430 4009 5101
Base content per 1 kb (bases) 459 541 314 144 238 303
Base content (%) 45.9% 54.1%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 5337 6041 3862 1475 2689 3352
Base content per 1 kb (bases) 469 531 339 130 236 295
Base content (%) 46.9% 53.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1542 bases) GC AT G C A T
Base content (bases) 633 909 372 261 398 511
Base content per 1 kb (bases) 411 589 241 169 258 331
Base content (%) 41.1% 58.9%
Total rRNA-coding genes (size: 2574 bases) GC AT G C A T
Base content (bases) 1176 1398 651 525 551 847
Base content per 1 kb (bases) 457 543 253 204 214 329
Base content (%) 45.7% 54.3%
12S rRNA gene (size: 976 bases) GC AT G C A T
Base content (bases) 473 503 266 207 202 301
Base content per 1 kb (bases) 485 515 273 212 207 308
Base content (%) 48.5% 51.5%
16S rRNA gene (size: 1598 bases) GC AT G C A T
Base content (bases) 703 895 385 318 349 546
Base content per 1 kb (bases) 440 560 241 199 218 342
Base content (%) 44.0% 56.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 308 376 242 66 161 215
Base content per 1 kb (bases) 450 550 354 96 235 314
Base content (%) 45.0% 55.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 59 13 47 49
Base content per 1 kb (bases) 429 571 351 77 280 292
Base content (%) 42.9% 57.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 756 795 489 267 373 422
Base content per 1 kb (bases) 487 513 315 172 240 272
Base content (%) 48.7% 51.3%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 311 373 210 101 162 211
Base content per 1 kb (bases) 454 545 307 147 236 308
Base content (%) 45.4% 54.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 386 398 260 126 188 210
Base content per 1 kb (bases) 492 508 332 161 240 268
Base content (%) 49.2% 50.8%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 543 600 388 155 278 322
Base content per 1 kb (bases) 475 525 339 136 243 282
Base content (%) 47.5% 52.5%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 459 519 309 150 267 252
Base content per 1 kb (bases) 469 531 316 153 273 258
Base content (%) 46.9% 53.1%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 463 577 354 109 264 313
Base content per 1 kb (bases) 445 555 340 105 254 301
Base content (%) 44.5% 55.5%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 155 196 114 41 90 106
Base content per 1 kb (bases) 442 558 325 117 256 302
Base content (%) 44.2% 55.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 657 721 501 156 307 414
Base content per 1 kb (bases) 477 523 364 113 223 300
Base content (%) 47.7% 52.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 143 154 106 37 75 79
Base content per 1 kb (bases) 481 519 357 125 253 266
Base content (%) 48.1% 51.9%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 837 981 629 208 420 561
Base content per 1 kb (bases) 460 540 346 114 231 309
Base content (%) 46.0% 54.0%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 252 267 204 48 61 206
Base content per 1 kb (bases) 486 514 393 92 118 397
Base content (%) 48.6% 51.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 60 (26.43%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 17 6 4 10 36 4 6 8 0 2 2 4 0 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 9 4 0 0 3 4 1 2 5 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 0 2 3 6 0 0 4 0 3 0 0 0 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 3 4 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 86 67 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 91 113 17
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMIISWLTFSFIIQPKLLSFVSMNPPSNKPPIAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 5 (9.09%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 1 1 0 3 0 0 2 0 0 0 1 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 1 0 0 0 0 0 4 3 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 0 0 0 2 3 0 0 1 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 0 2 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 17 20 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 23 8 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 19 21 12
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.95%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 37 (7.17%)
Methionine (Met, M)
n = 23 (4.46%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 31 15 5 14 34 4 6 9 0 6 14 16 5 4 39
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 5 25 16 0 6 10 23 8 2 11 17 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 15 1 2 10 11 1 0 4 1 16 0 1 4 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 10 0 3 12 8 1 1 2 5 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
159 123 126 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 229 202 56
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 23 (10.13%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 12 9 7 6 13 1 2 6 0 3 5 8 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 3 8 6 0 0 1 8 0 2 3 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 7 0 5 6 6 0 1 5 1 6 0 0 0 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 1 5 8 4 0 1 1 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 60 59 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 61 56 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 89 95 37
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 13 (5.0%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 13 4 4 6 17 4 1 9 0 4 5 8 0 3 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 10 10 0 1 7 11 1 2 6 3 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 0 2 7 5 0 2 2 1 9 1 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 0 0 5 4 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 73 54 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 70 54 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 117 102 31
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 24 (6.32%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 34 (8.95%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 22 5 5 17 36 4 1 8 0 3 5 14 2 2 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 3 17 6 2 3 7 10 4 3 10 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 14 0 4 9 7 1 0 1 0 12 0 0 2 19 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 1 2 6 10 0 2 2 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 114 99 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 99 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 175 144 46
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 26 (8.0%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 18 (5.54%)
Leucine (Leu, L)
n = 68 (20.92%)
Isoleucine (Ile, I)
n = 21 (6.46%)
Methionine (Met, M)
n = 10 (3.08%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 16 (4.92%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 14 (4.31%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 5 9 14 27 11 6 4 2 1 5 10 2 5 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 6 11 12 2 2 5 4 2 6 10 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 3 9 6 2 2 4 5 11 2 1 4 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 0 4 6 1 2 1 5 0 1 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 101 77 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 93 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 115 115 62
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 26 (7.54%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 36 (10.43%)
Methionine (Met, M)
n = 21 (6.09%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 25 14 9 20 20 8 9 9 1 0 4 1 1 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 6 7 13 0 0 6 5 2 3 11 7 0 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 12 0 5 11 9 2 0 5 0 7 2 0 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 13 1 0 2 1 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 101 128 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 114 58 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 139 126 56
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 26 (7.54%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 36 (10.43%)
Methionine (Met, M)
n = 21 (6.09%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 25 14 9 20 20 8 9 9 1 0 4 1 1 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 6 7 13 0 0 6 5 2 3 11 7 0 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 12 0 5 11 9 2 0 5 0 7 2 0 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 13 1 0 2 1 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 101 128 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 114 58 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 139 126 56
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 41 (8.95%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 43 (9.39%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 101 (22.05%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 23 (5.02%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 12 (2.62%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 30 15 8 29 51 6 6 14 0 1 5 4 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 3 6 18 16 1 0 10 6 2 3 13 10 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 20 0 2 15 10 1 0 8 0 13 0 1 1 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 2 0 2 9 1 0 1 10 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 160 143 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 139 80 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 202 191 43
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 15 (15.31%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 5 1 3 11 1 3 3 0 0 0 2 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 1 7 0 1 0 4 0 0 0 0 1 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 3 4 4 0 0 4 1 2 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 0 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 29 25 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 48 36 10
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 51 (8.43%)
Serine (Ser, S)
n = 54 (8.93%)
Threonine (Thr, T)
n = 62 (10.25%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 19 (3.14%)
Leucine (Leu, L)
n = 100 (16.53%)
Isoleucine (Ile, I)
n = 55 (9.09%)
Methionine (Met, M)
n = 28 (4.63%)
Proline (Pro, P)
n = 30 (4.96%)
Phenylalanine (Phe, F)
n = 38 (6.28%)
Tyrosine (Tyr, Y)
n = 14 (2.31%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 26 (4.3%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 38 25 2 27 61 4 6 17 0 1 8 10 0 6 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 6 8 27 16 0 1 10 18 4 9 13 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
36 20 0 5 21 16 0 0 12 0 14 1 0 4 22 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 1 2 6 21 0 0 2 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
123 160 205 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 185 109 240
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 284 247 62
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (18.02%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 15 (8.72%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 33 (19.19%)
Leucine (Leu, L)
n = 30 (17.44%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 6 (3.49%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 9 (5.23%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 1 5 0 0 2 9 0 0 14 1 4 14 8 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 5 0 2 5 6 1 2 22 1 0 1 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 1 7 0 3 1 4 0 7 0 3 14 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 3 0 0 0 0 0 0 4 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 15 18 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 29 18 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
76 4 25 68
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 225 (5.93%)
Alanine (Ala, A)
n = 308 (8.11%)
Serine (Ser, S)
n = 298 (7.85%)
Threonine (Thr, T)
n = 306 (8.06%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 196 (5.16%)
Leucine (Leu, L)
n = 667 (17.57%)
Isoleucine (Ile, I)
n = 297 (7.82%)
Methionine (Met, M)
n = 160 (4.21%)
Proline (Pro, P)
n = 221 (5.82%)
Phenylalanine (Phe, F)
n = 220 (5.8%)
Tyrosine (Tyr, Y)
n = 111 (2.92%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 90 (2.37%)
Asparagine (Asn, N)
n = 135 (3.56%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 100 (2.63%)
Lysine (Lys, K)
n = 86 (2.27%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
87 210 108 63 152 328 50 57 92 3 35 54 83 24 37 183
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
52 4 24 50 142 105 11 19 64 96 46 37 87 91 6 54
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
130 120 2 40 100 90 8 9 51 16 95 10 17 22 113 13
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
87 78 12 16 50 80 6 7 14 45 5 2 1 5 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
885 1080 1047 784
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
494 1073 689 1540
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
254 1556 1477 509

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.