Viewing data for Zaglossus bruijni


Scientific name Zaglossus bruijni
Common name Long-nosed echidna
Maximum lifespan 41.20 years (Zaglossus bruijni@AnAge)

Total mtDNA (size: 16367 bases) GC AT G C A T
Base content (bases) 6533 9834 4256 2277 4803 5031
Base content per 1 kb (bases) 399 601 260 139 293 307
Base content (%) 39.9% 60.1%
Total protein-coding genes (size: 11329 bases) GC AT G C A T
Base content (bases) 4609 6720 3162 1447 3380 3340
Base content per 1 kb (bases) 407 593 279 128 298 295
Base content (%) 40.7% 59.3%
D-loop (size: 909 bases) GC AT G C A T
Base content (bases) 348 561 201 147 312 249
Base content per 1 kb (bases) 383 617 221 162 343 274
Base content (%) 38.3% 61.7%
Total tRNA-coding genes (size: 1482 bases) GC AT G C A T
Base content (bases) 523 959 299 224 451 508
Base content per 1 kb (bases) 353 647 202 151 304 343
Base content (%) 35.3% 64.7%
Total rRNA-coding genes (size: 2511 bases) GC AT G C A T
Base content (bases) 996 1515 555 441 622 893
Base content per 1 kb (bases) 397 603 221 176 248 356
Base content (%) 39.7% 60.3%
12S rRNA gene (size: 941 bases) GC AT G C A T
Base content (bases) 392 549 223 169 215 334
Base content per 1 kb (bases) 417 583 237 180 228 355
Base content (%) 41.7% 58.3%
16S rRNA gene (size: 1570 bases) GC AT G C A T
Base content (bases) 604 966 332 272 407 559
Base content per 1 kb (bases) 385 615 211 173 259 356
Base content (%) 38.5% 61.5%

ATP6 (size: 679 bases) GC AT G C A T
Base content (bases) 266 413 190 76 216 197
Base content per 1 kb (bases) 392 608 280 112 318 290
Base content (%) 39.2% 60.8%
ATP8 (size: 210 bases) GC AT G C A T
Base content (bases) 80 130 61 19 64 66
Base content per 1 kb (bases) 381 619 290 90 305 314
Base content (%) 38.1% 61.9%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 655 887 395 260 494 393
Base content per 1 kb (bases) 425 575 256 169 320 255
Base content (%) 42.5% 57.5%
COX2 (size: 693 bases) GC AT G C A T
Base content (bases) 272 421 187 85 194 227
Base content per 1 kb (bases) 392 608 270 123 280 328
Base content (%) 39.2% 60.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 340 444 218 122 243 201
Base content per 1 kb (bases) 434 566 278 156 310 256
Base content (%) 43.4% 56.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 494 646 342 152 332 314
Base content per 1 kb (bases) 433 567 300 133 291 275
Base content (%) 43.3% 56.7%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 388 569 269 119 295 274
Base content per 1 kb (bases) 405 595 281 124 308 286
Base content (%) 40.5% 59.5%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 395 647 295 100 294 353
Base content per 1 kb (bases) 379 621 283 96 282 339
Base content (%) 37.9% 62.1%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 144 204 94 50 113 91
Base content per 1 kb (bases) 414 586 270 144 325 261
Base content (%) 41.4% 58.6%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 550 828 376 174 424 404
Base content per 1 kb (bases) 399 601 273 126 308 293
Base content (%) 39.9% 60.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 110 187 74 36 98 89
Base content per 1 kb (bases) 370 630 249 121 330 300
Base content (%) 37.0% 63.0%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 732 1083 516 216 539 544
Base content per 1 kb (bases) 403 597 284 119 297 300
Base content (%) 40.3% 59.7%
ND6 (size: 501 bases) GC AT G C A T
Base content (bases) 200 301 157 43 94 207
Base content per 1 kb (bases) 399 601 313 86 188 413
Base content (%) 39.9% 60.1%

ATP6 (size: 679 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (4.0%)
Alanine (Ala, A)
n = 16 (7.11%)
Serine (Ser, S)
n = 14 (6.22%)
Threonine (Thr, T)
n = 23 (10.22%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 9 (4.0%)
Leucine (Leu, L)
n = 44 (19.56%)
Isoleucine (Ile, I)
n = 28 (12.44%)
Methionine (Met, M)
n = 13 (5.78%)
Proline (Pro, P)
n = 14 (6.22%)
Phenylalanine (Phe, F)
n = 12 (5.33%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 4 (1.78%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.44%)
Glutamine (Gln, Q)
n = 7 (3.11%)
Histidine (His, H)
n = 5 (2.22%)
Lysine (Lys, K)
n = 4 (1.78%)
Arginine (Arg, R)
n = 6 (2.67%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 14 7 8 9 14 2 11 7 0 3 2 4 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 5 6 4 1 3 1 3 2 5 6 3 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 12 1 1 2 8 0 2 1 2 1 2 0 3 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 1 0 4 0 2 2 1 1 0 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 65 81 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 64 33 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 61 83 67
ATP8 (size: 210 bases)
Amino acid sequence: MPQLDTSTWFMTIFLMIFTIYGIFQLKVVKYLPTVLPTSSTQATPVTKLTPWNSKWTKIYLPHSLLLQS*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.45%)
Alanine (Ala, A)
n = 1 (1.45%)
Serine (Ser, S)
n = 6 (8.7%)
Threonine (Thr, T)
n = 11 (15.94%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (5.8%)
Leucine (Leu, L)
n = 10 (14.49%)
Isoleucine (Ile, I)
n = 5 (7.25%)
Methionine (Met, M)
n = 3 (4.35%)
Proline (Pro, P)
n = 6 (8.7%)
Phenylalanine (Phe, F)
n = 4 (5.8%)
Tyrosine (Tyr, Y)
n = 3 (4.35%)
Tryptophan (Trp, W)
n = 3 (4.35%)
Aspartic acid (Asp, D)
n = 1 (1.45%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 1 (1.45%)
Glutamine (Gln, Q)
n = 4 (5.8%)
Histidine (His, H)
n = 1 (1.45%)
Lysine (Lys, K)
n = 5 (7.25%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 2 1 2 2 1 3 3 1 2 1 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 1 0 0 3 3 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 2 3 2 1 0 0 0 2 1 0 1 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 1 0 4 1 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 17 25 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 24 16 26
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 20 25 17
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.97%)
Alanine (Ala, A)
n = 40 (7.8%)
Serine (Ser, S)
n = 31 (6.04%)
Threonine (Thr, T)
n = 37 (7.21%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 40 (7.8%)
Leucine (Leu, L)
n = 62 (12.09%)
Isoleucine (Ile, I)
n = 39 (7.6%)
Methionine (Met, M)
n = 28 (5.46%)
Proline (Pro, P)
n = 29 (5.65%)
Phenylalanine (Phe, F)
n = 42 (8.19%)
Tyrosine (Tyr, Y)
n = 18 (3.51%)
Tryptophan (Trp, W)
n = 18 (3.51%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 15 (2.92%)
Glutamine (Gln, Q)
n = 9 (1.75%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 19 23 15 10 18 4 11 9 0 17 13 9 1 23 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 13 14 13 0 10 15 14 7 8 8 12 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 16 1 2 13 13 0 2 1 13 5 7 4 8 7 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 3 10 5 8 1 2 2 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 111 131 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 93 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 150 169 161
COX2 (size: 693 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.48%)
Alanine (Ala, A)
n = 8 (3.48%)
Serine (Ser, S)
n = 22 (9.57%)
Threonine (Thr, T)
n = 20 (8.7%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 9 (3.91%)
Leucine (Leu, L)
n = 32 (13.91%)
Isoleucine (Ile, I)
n = 21 (9.13%)
Methionine (Met, M)
n = 16 (6.96%)
Proline (Pro, P)
n = 13 (5.65%)
Phenylalanine (Phe, F)
n = 7 (3.04%)
Tyrosine (Tyr, Y)
n = 9 (3.91%)
Tryptophan (Trp, W)
n = 5 (2.17%)
Aspartic acid (Asp, D)
n = 11 (4.78%)
Glutamic acid (Glu, E)
n = 13 (5.65%)
Asparagine (Asn, N)
n = 8 (3.48%)
Glutamine (Gln, Q)
n = 8 (3.48%)
Histidine (His, H)
n = 9 (3.91%)
Lysine (Lys, K)
n = 4 (1.74%)
Arginine (Arg, R)
n = 5 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 12 11 4 6 10 0 12 7 1 1 4 3 1 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 2 6 0 0 3 3 2 0 3 3 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 2 4 12 0 2 2 3 6 1 0 5 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 4 7 4 4 0 2 2 1 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 55 73 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 59 63 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 73 91 55
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 13 (5.0%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 3 6 3 10 4 12 8 0 5 4 6 1 12 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 4 7 2 0 3 12 3 3 4 3 4 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 6 0 4 7 7 1 1 2 4 9 0 0 4 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 2 2 1 3 0 0 2 2 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 62 59 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 64 58 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 92 84 67
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 33 (8.71%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 37 (9.76%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 8 (2.11%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 22 8 11 11 23 3 11 5 2 4 8 5 1 13 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 6 10 6 1 3 8 13 2 3 8 11 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 0 5 6 8 1 1 0 2 12 0 2 5 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 4 6 7 1 1 3 3 1 0 0 0 1 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 99 106 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 99 77 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 144 131 87
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.4%)
Alanine (Ala, A)
n = 23 (7.23%)
Serine (Ser, S)
n = 20 (6.29%)
Threonine (Thr, T)
n = 23 (7.23%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 15 (4.72%)
Leucine (Leu, L)
n = 61 (19.18%)
Isoleucine (Ile, I)
n = 31 (9.75%)
Methionine (Met, M)
n = 17 (5.35%)
Proline (Pro, P)
n = 21 (6.6%)
Phenylalanine (Phe, F)
n = 21 (6.6%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 4 (1.26%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 17 14 6 11 20 5 17 5 1 4 1 8 2 15 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 0 13 9 1 1 4 7 2 6 7 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 6 0 4 8 8 0 0 0 5 6 1 2 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 2 2 6 1 1 4 2 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 80 90 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 87 55 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 102 129 68
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 24 (6.94%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.05%)
Leucine (Leu, L)
n = 64 (18.5%)
Isoleucine (Ile, I)
n = 32 (9.25%)
Methionine (Met, M)
n = 27 (7.8%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 18 (5.2%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 16 24 9 13 22 4 14 9 0 3 2 8 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 5 11 0 0 4 9 1 4 12 6 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 17 1 1 8 12 0 1 2 5 6 1 2 8 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 1 0 0 9 4 0 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 90 134 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 103 63 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 102 156 71
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 24 (6.94%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.05%)
Leucine (Leu, L)
n = 64 (18.5%)
Isoleucine (Ile, I)
n = 32 (9.25%)
Methionine (Met, M)
n = 27 (7.8%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 18 (5.2%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 16 24 9 13 22 4 14 9 0 3 2 8 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 5 11 0 0 4 9 1 4 12 6 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 17 1 1 8 12 0 1 2 5 6 1 2 8 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 1 0 0 9 4 0 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 90 134 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 103 63 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 102 156 71
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.37%)
Alanine (Ala, A)
n = 30 (6.55%)
Serine (Ser, S)
n = 42 (9.17%)
Threonine (Thr, T)
n = 30 (6.55%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 96 (20.96%)
Isoleucine (Ile, I)
n = 46 (10.04%)
Methionine (Met, M)
n = 31 (6.77%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 20 (4.37%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 20 (4.37%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 17 22 13 14 31 13 20 10 0 5 3 8 0 7 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 3 10 13 7 0 4 6 7 3 6 9 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 0 4 12 15 0 5 6 7 7 3 5 5 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 3 1 3 11 0 1 1 7 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 124 149 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 112 81 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 140 174 108
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 5 (5.1%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 9 5 5 4 2 6 1 0 2 1 2 1 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 0 1 0 3 1 0 1 3 1 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 1 3 3 0 0 0 1 3 0 0 0 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 2 1 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 23 28 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 20 21 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 31 40 22
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.13%)
Alanine (Ala, A)
n = 43 (7.12%)
Serine (Ser, S)
n = 51 (8.44%)
Threonine (Thr, T)
n = 52 (8.61%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 18 (2.98%)
Leucine (Leu, L)
n = 99 (16.39%)
Isoleucine (Ile, I)
n = 61 (10.1%)
Methionine (Met, M)
n = 31 (5.13%)
Proline (Pro, P)
n = 27 (4.47%)
Phenylalanine (Phe, F)
n = 45 (7.45%)
Tyrosine (Tyr, Y)
n = 14 (2.32%)
Tryptophan (Trp, W)
n = 13 (2.15%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 12 (1.99%)
Asparagine (Asn, N)
n = 31 (5.13%)
Glutamine (Gln, Q)
n = 18 (2.98%)
Histidine (His, H)
n = 14 (2.32%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 35 25 21 15 38 4 18 15 3 4 5 9 0 19 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 2 17 17 9 0 7 6 11 7 7 9 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 21 2 7 17 15 2 5 5 5 9 1 3 10 21 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 11 1 3 7 16 4 1 0 7 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
114 146 205 140
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 163 120 254
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 207 219 145
ND6 (size: 501 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (15.06%)
Alanine (Ala, A)
n = 7 (4.22%)
Serine (Ser, S)
n = 11 (6.63%)
Threonine (Thr, T)
n = 6 (3.61%)
Cysteine (Cys, C)
n = 2 (1.2%)
Valine (Val, V)
n = 21 (12.65%)
Leucine (Leu, L)
n = 27 (16.27%)
Isoleucine (Ile, I)
n = 10 (6.02%)
Methionine (Met, M)
n = 9 (5.42%)
Proline (Pro, P)
n = 3 (1.81%)
Phenylalanine (Phe, F)
n = 12 (7.23%)
Tyrosine (Tyr, Y)
n = 9 (5.42%)
Tryptophan (Trp, W)
n = 4 (2.41%)
Aspartic acid (Asp, D)
n = 5 (3.01%)
Glutamic acid (Glu, E)
n = 9 (5.42%)
Asparagine (Asn, N)
n = 3 (1.81%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.6%)
Lysine (Lys, K)
n = 1 (0.6%)
Arginine (Arg, R)
n = 1 (0.6%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 2 3 2 1 2 2 11 0 0 6 1 5 9 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 5 1 0 1 9 0 4 12 2 1 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 2 1 2 0 4 2 9 0 4 9 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 8 5 0 1 0 1 0 0 0 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 12 35 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 21 29 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 10 30 75
Total protein-coding genes (size: 11386 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 226 (5.96%)
Alanine (Ala, A)
n = 234 (6.17%)
Serine (Ser, S)
n = 281 (7.41%)
Threonine (Thr, T)
n = 312 (8.23%)
Cysteine (Cys, C)
n = 26 (0.69%)
Valine (Val, V)
n = 190 (5.01%)
Leucine (Leu, L)
n = 644 (16.98%)
Isoleucine (Ile, I)
n = 338 (8.91%)
Methionine (Met, M)
n = 203 (5.35%)
Proline (Pro, P)
n = 198 (5.22%)
Phenylalanine (Phe, F)
n = 238 (6.27%)
Tyrosine (Tyr, Y)
n = 128 (3.37%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 94 (2.48%)
Asparagine (Asn, N)
n = 151 (3.98%)
Glutamine (Gln, Q)
n = 90 (2.37%)
Histidine (His, H)
n = 102 (2.69%)
Lysine (Lys, K)
n = 89 (2.35%)
Arginine (Arg, R)
n = 66 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
168 170 151 105 108 204 44 155 81 9 57 45 70 18 127 111
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
52 14 12 67 94 68 5 44 62 78 42 54 72 69 3 76
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
101 128 7 39 85 107 5 24 21 59 69 21 28 55 96 34
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 68 26 36 32 76 13 11 17 32 6 0 1 5 3 86
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
812 917 1139 926
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
471 980 730 1613
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
283 1163 1378 970

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.