Viewing data for Anguilla anguilla


Scientific name Anguilla anguilla
Common name European eel
Maximum lifespan 88.00 years (Anguilla anguilla@AnAge)

Total mtDNA (size: 16683 bases) GC AT G C A T
Base content (bases) 6868 9815 4255 2613 4210 5605
Base content per 1 kb (bases) 412 588 255 157 252 336
Base content (%) 41.2% 58.8%
Total protein-coding genes (size: 11447 bases) GC AT G C A T
Base content (bases) 4716 6731 3051 1665 3013 3718
Base content per 1 kb (bases) 412 588 267 145 263 325
Base content (%) 41.2% 58.8%
D-loop (size: 964 bases) GC AT G C A T
Base content (bases) 287 677 185 102 293 384
Base content per 1 kb (bases) 298 702 192 106 304 398
Base content (%) 29.8% 70.2%
Total tRNA-coding genes (size: 1563 bases) GC AT G C A T
Base content (bases) 674 889 373 301 391 498
Base content per 1 kb (bases) 431 569 239 193 250 319
Base content (%) 43.1% 56.9%
Total rRNA-coding genes (size: 2657 bases) GC AT G C A T
Base content (bases) 1167 1490 634 533 502 988
Base content per 1 kb (bases) 439 561 239 201 189 372
Base content (%) 43.9% 56.1%
12S rRNA gene (size: 949 bases) GC AT G C A T
Base content (bases) 440 509 239 201 182 327
Base content per 1 kb (bases) 464 536 252 212 192 345
Base content (%) 46.4% 53.6%
16S rRNA gene (size: 1708 bases) GC AT G C A T
Base content (bases) 727 981 395 332 320 661
Base content per 1 kb (bases) 426 574 231 194 187 387
Base content (%) 42.6% 57.4%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 271 412 184 87 196 216
Base content per 1 kb (bases) 397 603 269 127 287 316
Base content (%) 39.7% 60.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 48 22 40 58
Base content per 1 kb (bases) 417 583 286 131 238 345
Base content (%) 41.7% 58.3%
COX1 (size: 1593 bases) GC AT G C A T
Base content (bases) 680 913 396 284 462 451
Base content per 1 kb (bases) 427 573 249 178 290 283
Base content (%) 42.7% 57.3%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 293 398 176 117 174 224
Base content per 1 kb (bases) 424 576 255 169 252 324
Base content (%) 42.4% 57.6%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 341 444 213 128 213 231
Base content per 1 kb (bases) 434 566 271 163 271 294
Base content (%) 43.4% 56.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 484 656 312 172 323 333
Base content per 1 kb (bases) 425 575 274 151 283 292
Base content (%) 42.5% 57.5%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 411 561 273 138 251 310
Base content per 1 kb (bases) 423 577 281 142 258 319
Base content (%) 42.3% 57.7%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 412 633 280 132 236 397
Base content per 1 kb (bases) 394 606 268 126 226 380
Base content (%) 39.4% 60.6%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 149 200 94 55 107 93
Base content per 1 kb (bases) 427 573 269 158 307 266
Base content (%) 42.7% 57.3%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 554 827 357 197 377 450
Base content per 1 kb (bases) 401 599 259 143 273 326
Base content (%) 40.1% 59.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 134 163 91 43 86 77
Base content per 1 kb (bases) 451 549 306 145 290 259
Base content (%) 45.1% 54.9%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 717 1125 479 238 480 645
Base content per 1 kb (bases) 389 611 260 129 261 350
Base content (%) 38.9% 61.1%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 205 317 151 54 74 243
Base content per 1 kb (bases) 393 607 289 103 142 466
Base content (%) 39.3% 60.7%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 9 (3.98%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (7.96%)
Leucine (Leu, L)
n = 52 (23.01%)
Isoleucine (Ile, I)
n = 17 (7.52%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 8 10 8 4 24 5 11 9 0 5 3 8 2 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 4 8 0 1 4 6 0 4 1 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 0 1 2 1 0 0 5 2 3 1 0 4 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 1 0 1 0 5 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 75 67 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 58 31 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 51 117 48
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFTILVFSWAVFLAILPTKVMAHTFNNEPSPQTAKKPKLDSWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 1 0 1 1 1 2 2 0 0 0 2 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 2 2 0 0 0 0 0 1 2 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 1 0 1 0 0 1 0 1 1 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 1 0 1 4 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 14 17 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 19 15 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 15 26 9
COX1 (size: 1593 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.06%)
Alanine (Ala, A)
n = 46 (8.68%)
Serine (Ser, S)
n = 27 (5.09%)
Threonine (Thr, T)
n = 38 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.3%)
Leucine (Leu, L)
n = 62 (11.7%)
Isoleucine (Ile, I)
n = 39 (7.36%)
Methionine (Met, M)
n = 23 (4.34%)
Proline (Pro, P)
n = 30 (5.66%)
Phenylalanine (Phe, F)
n = 41 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.58%)
Tryptophan (Trp, W)
n = 18 (3.4%)
Aspartic acid (Asp, D)
n = 17 (3.21%)
Glutamic acid (Glu, E)
n = 14 (2.64%)
Asparagine (Asn, N)
n = 14 (2.64%)
Glutamine (Gln, Q)
n = 8 (1.51%)
Histidine (His, H)
n = 20 (3.77%)
Lysine (Lys, K)
n = 12 (2.26%)
Arginine (Arg, R)
n = 9 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 15 15 11 6 24 7 14 7 1 9 8 25 2 20 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 9 20 16 1 6 14 21 7 3 6 20 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 18 2 5 7 11 0 1 3 10 9 0 0 8 6 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 12 2 7 10 11 1 4 0 4 1 0 1 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
169 115 131 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 137 104 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 144 216 137
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 21 (9.17%)
Serine (Ser, S)
n = 13 (5.68%)
Threonine (Thr, T)
n = 9 (3.93%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 27 (11.79%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 9 4 2 13 2 6 8 1 5 4 10 2 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 0 7 12 2 1 1 7 0 2 3 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 2 1 6 1 0 3 6 3 0 0 1 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 2 1 12 3 0 0 1 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 60 51 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 63 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 62 110 44
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 18 (6.92%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 27 (10.38%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 28 (10.77%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 8 4 2 18 0 3 9 0 4 4 6 3 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 10 6 0 3 6 10 3 1 3 7 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 1 1 9 0 0 3 8 4 1 1 0 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 1 0 5 3 0 0 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 65 59 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 68 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 80 116 53
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 29 (7.65%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 25 (6.6%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 8 (2.11%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 11 12 13 5 30 3 9 5 1 5 4 16 4 7 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 5 13 9 0 1 5 14 6 2 1 15 4 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 2 9 13 0 0 0 7 9 1 1 5 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 3 8 7 1 0 1 7 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 99 88 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 93 80 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 120 165 71
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.57%)
Alanine (Ala, A)
n = 34 (10.53%)
Serine (Ser, S)
n = 18 (5.57%)
Threonine (Thr, T)
n = 21 (6.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 17 (5.26%)
Leucine (Leu, L)
n = 60 (18.58%)
Isoleucine (Ile, I)
n = 24 (7.43%)
Methionine (Met, M)
n = 16 (4.95%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 16 (4.95%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.72%)
Asparagine (Asn, N)
n = 16 (4.95%)
Glutamine (Gln, Q)
n = 5 (1.55%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 11 11 10 3 31 2 14 3 2 2 3 12 0 6 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 3 19 12 0 1 5 9 3 3 4 16 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 1 0 3 13 0 0 2 7 5 1 0 3 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 12 0 0 3 7 1 1 1 4 2 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 86 87 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 95 60 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 92 163 51
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 34 (9.8%)
Serine (Ser, S)
n = 17 (4.9%)
Threonine (Thr, T)
n = 46 (13.26%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 33 (9.51%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 11 28 3 9 30 4 7 13 1 0 2 8 1 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 7 11 16 0 1 3 11 4 0 5 13 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 35 0 1 1 11 1 1 2 3 5 0 4 3 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 1 1 13 0 0 0 3 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 90 132 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 113 60 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 77 205 44
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 34 (9.8%)
Serine (Ser, S)
n = 17 (4.9%)
Threonine (Thr, T)
n = 46 (13.26%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 33 (9.51%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 11 28 3 9 30 4 7 13 1 0 2 8 1 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 7 11 16 0 1 3 11 4 0 5 13 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 35 0 1 1 11 1 1 2 3 5 0 4 3 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 1 1 13 0 0 0 3 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 90 132 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 113 60 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 77 205 44
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 34 (7.41%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 40 (8.71%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 17 (3.7%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 42 (9.15%)
Methionine (Met, M)
n = 29 (6.32%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.83%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 16 22 8 12 37 5 20 10 1 3 2 12 0 5 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 4 6 12 15 1 3 6 17 3 3 3 18 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 16 2 5 6 12 0 2 3 7 8 3 4 4 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 1 2 3 12 1 0 1 10 1 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 119 142 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 121 79 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 117 229 85
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 5 2 2 9 1 4 2 0 0 0 3 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 8 3 0 0 3 0 1 0 1 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 1 4 4 0 1 1 0 1 0 2 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 1 0 1 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 25 21 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 32 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 34 40 18
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 52 (8.48%)
Serine (Ser, S)
n = 36 (5.87%)
Threonine (Thr, T)
n = 56 (9.14%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 29 (4.73%)
Leucine (Leu, L)
n = 85 (13.87%)
Isoleucine (Ile, I)
n = 52 (8.48%)
Methionine (Met, M)
n = 41 (6.69%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 41 (6.69%)
Tyrosine (Tyr, Y)
n = 13 (2.12%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 32 (5.22%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 13 (2.12%)
Lysine (Lys, K)
n = 26 (4.24%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 18 34 12 10 43 4 15 22 0 7 5 15 2 16 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 3 7 21 21 3 2 9 17 3 2 5 21 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 33 2 3 5 15 1 0 12 4 9 1 1 9 23 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 1 5 8 24 2 0 0 9 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
137 143 219 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 162 132 248
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 174 294 117
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.87%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 5 (2.89%)
Valine (Val, V)
n = 19 (10.98%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 10 (5.78%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 13 (7.51%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 0 2 7 0 0 0 10 0 0 10 0 3 6 13 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 5 0 12 2 2 1 10 0 3 11 2 0 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 2 1 3 0 12 1 1 11 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 4 4 1 0 0 4 0 1 1 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 17 20 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 31 25 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 6 29 100
Total protein-coding genes (size: 11468 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 247 (6.47%)
Alanine (Ala, A)
n = 322 (8.43%)
Serine (Ser, S)
n = 219 (5.73%)
Threonine (Thr, T)
n = 301 (7.88%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 233 (6.1%)
Leucine (Leu, L)
n = 593 (15.53%)
Isoleucine (Ile, I)
n = 282 (7.38%)
Methionine (Met, M)
n = 210 (5.5%)
Proline (Pro, P)
n = 214 (5.6%)
Phenylalanine (Phe, F)
n = 230 (6.02%)
Tyrosine (Tyr, Y)
n = 126 (3.3%)
Tryptophan (Trp, W)
n = 121 (3.17%)
Aspartic acid (Asp, D)
n = 81 (2.12%)
Glutamic acid (Glu, E)
n = 104 (2.72%)
Asparagine (Asn, N)
n = 131 (3.43%)
Glutamine (Gln, Q)
n = 100 (2.62%)
Histidine (His, H)
n = 99 (2.59%)
Lysine (Lys, K)
n = 93 (2.44%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
177 105 160 86 60 269 37 116 92 8 50 37 122 24 94 136
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
50 13 17 59 130 125 8 30 56 117 44 25 36 141 12 53
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
76 164 8 27 42 103 4 8 35 67 59 10 25 44 87 36
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 90 14 24 57 87 6 11 6 54 6 0 1 5 1 111
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
987 942 1061 830
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
519 1013 740 1548
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
258 1002 1756 804

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.