Viewing data for Alectura lathami


Scientific name Alectura lathami
Common name Brush turkey
Maximum lifespan 12.50 years (Alectura lathami@AnAge)

Total mtDNA (size: 16698 bases) GC AT G C A T
Base content (bases) 7901 8796 5395 2506 3971 4825
Base content per 1 kb (bases) 473 527 323 150 238 289
Base content (%) 47.3% 52.7%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5460 5918 3895 1565 2748 3170
Base content per 1 kb (bases) 480 520 342 138 242 279
Base content (%) 48.0% 52.0%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1557 bases) GC AT G C A T
Base content (bases) 674 883 393 281 384 499
Base content per 1 kb (bases) 433 567 252 180 247 320
Base content (%) 43.3% 56.7%
Total rRNA-coding genes (size: 2595 bases) GC AT G C A T
Base content (bases) 1244 1351 749 495 503 848
Base content per 1 kb (bases) 479 521 289 191 194 327
Base content (%) 47.9% 52.1%
12S rRNA gene (size: 980 bases) GC AT G C A T
Base content (bases) 480 500 288 192 188 312
Base content per 1 kb (bases) 490 510 294 196 192 318
Base content (%) 49.0% 51.0%
16S rRNA gene (size: 1615 bases) GC AT G C A T
Base content (bases) 764 851 461 303 315 536
Base content per 1 kb (bases) 473 527 285 188 195 332
Base content (%) 47.3% 52.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 333 351 255 78 173 178
Base content per 1 kb (bases) 487 513 373 114 253 260
Base content (%) 48.7% 51.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 76 92 65 11 38 54
Base content per 1 kb (bases) 452 548 387 65 226 321
Base content (%) 45.2% 54.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 753 798 478 275 408 390
Base content per 1 kb (bases) 485 515 308 177 263 251
Base content (%) 48.5% 51.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 318 366 205 113 168 198
Base content per 1 kb (bases) 465 535 300 165 246 289
Base content (%) 46.5% 53.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 399 385 269 130 186 199
Base content per 1 kb (bases) 509 491 343 166 237 254
Base content (%) 50.9% 49.1%
CYTB (size: 1142 bases) GC AT G C A T
Base content (bases) 555 587 406 149 280 307
Base content per 1 kb (bases) 486 514 356 130 245 269
Base content (%) 48.6% 51.4%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 470 508 318 152 261 247
Base content per 1 kb (bases) 481 519 325 155 267 253
Base content (%) 48.1% 51.9%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 483 558 367 116 254 304
Base content per 1 kb (bases) 464 536 353 111 244 292
Base content (%) 46.4% 53.6%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 169 183 124 45 96 87
Base content per 1 kb (bases) 480 520 352 128 273 247
Base content (%) 48.0% 52.0%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 637 741 485 152 337 404
Base content per 1 kb (bases) 462 538 352 110 245 293
Base content (%) 46.2% 53.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 148 149 103 45 77 72
Base content per 1 kb (bases) 498 502 347 152 259 242
Base content (%) 49.8% 50.2%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 873 942 627 246 410 532
Base content per 1 kb (bases) 481 519 345 136 226 293
Base content (%) 48.1% 51.9%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 251 271 196 55 64 207
Base content per 1 kb (bases) 481 519 375 105 123 397
Base content (%) 48.1% 51.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 19 (8.37%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 10 7 4 23 19 9 7 6 2 2 3 3 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 9 3 0 1 3 3 1 5 10 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 3 2 3 4 0 0 5 2 2 0 0 3 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 1 0 3 0 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 91 66 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 67 35 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 97 77 35
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFTIMIFTWLTLSLIIQPKLLSFTSANPPSNKTLTTLKANPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 0 2 1 3 1 1 1 1 0 0 0 0 0 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 1 0 0 0 0 0 0 4 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 0 0 1 2 1 0 0 0 0 0 0 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 17 23 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 23 11 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 25 20 7
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 26 (5.04%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 33 (6.4%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 44 (8.53%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 31 20 5 18 17 11 10 8 1 4 10 16 3 13 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 11 19 15 1 5 16 16 10 10 9 9 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 9 3 4 11 8 0 0 3 7 10 2 1 1 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 5 5 4 11 8 1 2 2 4 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 118 136 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 94 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 221 160 89
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 12 (5.29%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 10 (4.41%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 14 7 4 7 10 6 3 7 0 7 3 5 1 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 4 9 6 0 1 0 7 1 0 7 5 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 0 2 6 6 1 1 1 1 7 2 1 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 13 1 5 7 3 2 0 0 4 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 62 52 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 59 62 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 84 84 41
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 12 6 3 14 11 6 0 6 1 3 10 2 0 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 7 11 1 3 7 8 2 1 4 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 3 6 6 0 1 4 0 10 3 0 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 2 1 3 3 1 0 0 4 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 74 57 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 69 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 126 88 28
CYTB (size: 1142 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 31 (8.18%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 15 (3.96%)
Leucine (Leu, L)
n = 66 (17.41%)
Isoleucine (Ile, I)
n = 33 (8.71%)
Methionine (Met, M)
n = 10 (2.64%)
Proline (Pro, P)
n = 25 (6.6%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 19 (5.01%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 25 8 5 21 32 3 4 7 1 1 5 7 2 5 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 1 4 16 11 0 1 12 9 2 1 12 10 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 7 0 2 13 8 0 0 1 2 11 0 1 4 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 2 1 7 10 0 0 4 3 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 114 97 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 103 77 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 189 132 43
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 29 (8.92%)
Serine (Ser, S)
n = 28 (8.62%)
Threonine (Thr, T)
n = 20 (6.15%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 65 (20.0%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 13 (4.0%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 12 (3.69%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 11 (3.38%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 8 (2.46%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 15 9 9 17 26 6 5 4 2 4 5 4 4 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 8 14 7 0 2 1 3 8 4 7 12 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 5 2 3 10 8 1 2 4 6 6 4 2 3 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 2 0 4 8 0 0 3 5 0 0 1 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 100 82 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 95 56 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 123 109 57
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 30 (8.67%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 31 (8.96%)
Methionine (Met, M)
n = 16 (4.62%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 21 13 7 20 25 5 5 10 1 1 4 3 3 3 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 13 12 1 0 8 2 1 3 13 6 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 15 1 4 9 11 3 2 3 1 5 2 3 2 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 1 1 1 11 2 1 0 2 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 103 119 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 121 59 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 143 126 50
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 30 (8.67%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 31 (8.96%)
Methionine (Met, M)
n = 16 (4.62%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 21 13 7 20 25 5 5 10 1 1 4 3 3 3 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 13 12 1 0 8 2 1 3 13 6 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 15 1 4 9 11 3 2 3 1 5 2 3 2 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 1 1 1 11 2 1 0 2 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 103 119 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 121 59 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 143 126 50
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 52 (11.35%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 8 (1.75%)
Leucine (Leu, L)
n = 101 (22.05%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 24 (5.24%)
Proline (Pro, P)
n = 34 (7.42%)
Phenylalanine (Phe, F)
n = 14 (3.06%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 12 (2.62%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 23 19 8 28 46 5 14 8 3 4 2 2 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 5 19 6 1 1 8 7 2 7 13 13 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 23 3 5 12 12 0 2 9 3 11 3 0 1 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 2 0 3 10 1 1 1 7 2 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 157 147 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 146 74 184
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 182 183 66
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 7 (7.14%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 4 2 4 6 2 4 1 0 0 2 1 1 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 0 5 3 0 1 3 1 0 0 2 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 0 4 4 2 0 2 0 2 0 1 2 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 1 2 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 28 21 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 46 33 10
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.3%)
Alanine (Ala, A)
n = 53 (8.77%)
Serine (Ser, S)
n = 47 (7.78%)
Threonine (Thr, T)
n = 75 (12.42%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 18 (2.98%)
Leucine (Leu, L)
n = 105 (17.38%)
Isoleucine (Ile, I)
n = 48 (7.95%)
Methionine (Met, M)
n = 28 (4.64%)
Proline (Pro, P)
n = 31 (5.13%)
Phenylalanine (Phe, F)
n = 31 (5.13%)
Tyrosine (Tyr, Y)
n = 11 (1.82%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 14 (2.32%)
Asparagine (Asn, N)
n = 21 (3.48%)
Glutamine (Gln, Q)
n = 15 (2.48%)
Histidine (His, H)
n = 16 (2.65%)
Lysine (Lys, K)
n = 23 (3.81%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 28 20 9 35 37 12 8 14 1 2 9 4 3 6 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 4 9 27 17 0 4 14 12 2 4 9 16 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
37 29 5 3 20 9 2 1 12 1 10 2 4 5 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 5 3 7 22 1 0 3 5 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
127 164 208 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 193 111 230
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 270 213 74
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (17.34%)
Alanine (Ala, A)
n = 11 (6.36%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 35 (20.23%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 1 4 0 1 3 11 0 0 13 3 6 13 14 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 4 0 3 4 4 1 2 23 3 1 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 0 3 3 2 6 2 3 7 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 4 1 0 0 0 0 2 3 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 17 17 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 27 18 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
66 11 29 68
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 223 (5.87%)
Alanine (Ala, A)
n = 303 (7.98%)
Serine (Ser, S)
n = 286 (7.53%)
Threonine (Thr, T)
n = 338 (8.9%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 184 (4.85%)
Leucine (Leu, L)
n = 671 (17.68%)
Isoleucine (Ile, I)
n = 283 (7.46%)
Methionine (Met, M)
n = 158 (4.16%)
Proline (Pro, P)
n = 235 (6.19%)
Phenylalanine (Phe, F)
n = 220 (5.8%)
Tyrosine (Tyr, Y)
n = 107 (2.82%)
Tryptophan (Trp, W)
n = 108 (2.85%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 123 (3.24%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 111 (2.92%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
90 193 116 64 201 237 74 75 76 13 41 57 55 31 67 153
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
42 9 18 57 140 98 8 24 75 72 52 39 96 88 12 43
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
164 114 17 35 100 80 12 13 46 30 77 21 20 26 97 19
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
92 67 25 22 46 82 8 5 16 41 9 0 2 6 2 87
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
870 1082 1053 792
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
490 1103 688 1516
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
348 1571 1294 584

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.