Viewing data for Anguilla rostrata


Scientific name Anguilla rostrata
Common name American eel
Maximum lifespan 50.00 years (Anguilla rostrata@AnAge)

Total mtDNA (size: 16678 bases) GC AT G C A T
Base content (bases) 6827 9851 4226 2601 4234 5617
Base content per 1 kb (bases) 409 591 253 156 254 337
Base content (%) 40.9% 59.1%
Total protein-coding genes (size: 11447 bases) GC AT G C A T
Base content (bases) 4678 6769 3031 1647 3031 3738
Base content per 1 kb (bases) 409 591 265 144 265 327
Base content (%) 40.9% 59.1%
D-loop (size: 962 bases) GC AT G C A T
Base content (bases) 288 674 181 107 294 380
Base content per 1 kb (bases) 299 701 188 111 306 395
Base content (%) 29.9% 70.1%
Total tRNA-coding genes (size: 1563 bases) GC AT G C A T
Base content (bases) 674 889 374 300 391 498
Base content per 1 kb (bases) 431 569 239 192 250 319
Base content (%) 43.1% 56.9%
Total rRNA-coding genes (size: 2655 bases) GC AT G C A T
Base content (bases) 1163 1492 630 533 507 985
Base content per 1 kb (bases) 438 562 237 201 191 371
Base content (%) 43.8% 56.2%
12S rRNA gene (size: 947 bases) GC AT G C A T
Base content (bases) 437 510 236 201 185 325
Base content per 1 kb (bases) 461 539 249 212 195 343
Base content (%) 46.1% 53.9%
16S rRNA gene (size: 1708 bases) GC AT G C A T
Base content (bases) 726 982 394 332 322 660
Base content per 1 kb (bases) 425 575 231 194 189 386
Base content (%) 42.5% 57.5%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 264 419 176 88 200 219
Base content per 1 kb (bases) 387 613 258 129 293 321
Base content (%) 38.7% 61.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 50 22 39 57
Base content per 1 kb (bases) 429 571 298 131 232 339
Base content (%) 42.9% 57.1%
COX1 (size: 1593 bases) GC AT G C A T
Base content (bases) 683 910 397 286 462 448
Base content per 1 kb (bases) 429 571 249 180 290 281
Base content (%) 42.9% 57.1%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 295 396 177 118 172 224
Base content per 1 kb (bases) 427 573 256 171 249 324
Base content (%) 42.7% 57.3%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 335 450 210 125 216 234
Base content per 1 kb (bases) 427 573 268 159 275 298
Base content (%) 42.7% 57.3%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 475 665 309 166 328 337
Base content per 1 kb (bases) 417 583 271 146 288 296
Base content (%) 41.7% 58.3%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 407 565 272 135 250 315
Base content per 1 kb (bases) 419 581 280 139 257 324
Base content (%) 41.9% 58.1%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 408 637 278 130 235 402
Base content per 1 kb (bases) 390 610 266 124 225 385
Base content (%) 39.0% 61.0%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 152 197 99 53 101 96
Base content per 1 kb (bases) 436 564 284 152 289 275
Base content (%) 43.6% 56.4%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 552 829 360 192 375 454
Base content per 1 kb (bases) 400 600 261 139 272 329
Base content (%) 40.0% 60.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 132 165 89 43 88 77
Base content per 1 kb (bases) 444 556 300 145 296 259
Base content (%) 44.4% 55.6%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 703 1139 470 233 491 648
Base content per 1 kb (bases) 382 618 255 126 267 352
Base content (%) 38.2% 61.8%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 205 317 147 58 80 237
Base content per 1 kb (bases) 393 607 282 111 153 454
Base content (%) 39.3% 60.7%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 9 (3.98%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 19 (8.41%)
Leucine (Leu, L)
n = 51 (22.57%)
Isoleucine (Ile, I)
n = 15 (6.64%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 5 10 8 2 23 7 11 9 0 5 2 11 1 8 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 4 8 0 2 2 5 1 4 1 10 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 17 1 1 3 0 0 1 4 3 2 0 0 5 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 1 0 1 0 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 74 67 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 32 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 42 119 53
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFTILVFSWAVFLAILPTKVMAHTFNNEPSPQTAKKPKLDSWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 1 0 1 1 1 2 2 0 0 0 1 2 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 3 1 0 0 0 0 0 1 2 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 0 1 1 0 0 1 0 1 1 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 1 4 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 14 17 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 19 15 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 17 25 8
COX1 (size: 1593 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.06%)
Alanine (Ala, A)
n = 46 (8.68%)
Serine (Ser, S)
n = 27 (5.09%)
Threonine (Thr, T)
n = 38 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.3%)
Leucine (Leu, L)
n = 62 (11.7%)
Isoleucine (Ile, I)
n = 39 (7.36%)
Methionine (Met, M)
n = 23 (4.34%)
Proline (Pro, P)
n = 30 (5.66%)
Phenylalanine (Phe, F)
n = 41 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.58%)
Tryptophan (Trp, W)
n = 18 (3.4%)
Aspartic acid (Asp, D)
n = 17 (3.21%)
Glutamic acid (Glu, E)
n = 14 (2.64%)
Asparagine (Asn, N)
n = 14 (2.64%)
Glutamine (Gln, Q)
n = 8 (1.51%)
Histidine (His, H)
n = 20 (3.77%)
Lysine (Lys, K)
n = 12 (2.26%)
Arginine (Arg, R)
n = 9 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 15 15 12 5 27 7 10 8 0 8 9 24 3 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 10 19 16 1 8 12 21 7 4 6 18 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 17 3 5 7 11 0 1 3 9 10 0 1 9 5 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 13 1 6 11 11 1 4 0 4 1 0 1 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
169 118 131 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 137 104 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 142 213 140
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 20 (8.73%)
Serine (Ser, S)
n = 13 (5.68%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 27 (11.79%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 9 4 2 14 2 5 8 1 5 3 11 2 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 0 6 13 1 1 1 6 1 2 3 7 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 0 2 1 6 1 0 3 5 4 0 0 1 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 2 1 12 3 0 0 1 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 61 52 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 63 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 62 109 43
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 19 (7.31%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 27 (10.38%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 28 (10.77%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 5 8 3 2 18 0 4 9 0 4 4 6 3 8 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 3 10 6 0 2 6 10 3 1 3 7 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 1 1 9 0 0 3 8 4 0 1 0 1 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 0 2 3 3 0 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 64 59 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 69 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 77 119 55
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 29 (7.65%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 25 (6.6%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 12 10 14 4 29 2 10 4 2 2 7 17 3 10 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 4 14 9 0 2 6 13 5 3 1 18 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 4 7 13 0 0 0 7 9 0 2 5 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 4 7 8 1 0 1 7 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 97 88 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 93 81 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 119 168 75
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.57%)
Alanine (Ala, A)
n = 34 (10.53%)
Serine (Ser, S)
n = 18 (5.57%)
Threonine (Thr, T)
n = 21 (6.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (5.57%)
Leucine (Leu, L)
n = 59 (18.27%)
Isoleucine (Ile, I)
n = 23 (7.12%)
Methionine (Met, M)
n = 17 (5.26%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 16 (4.95%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.72%)
Asparagine (Asn, N)
n = 16 (4.95%)
Glutamine (Gln, Q)
n = 5 (1.55%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 13 13 10 3 33 2 11 3 2 4 2 12 0 7 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 19 12 0 0 6 9 3 3 3 17 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 0 0 3 13 0 0 2 8 4 0 0 4 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 12 0 0 3 8 0 2 0 4 2 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 88 87 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 95 60 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 89 168 53
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 35 (10.09%)
Serine (Ser, S)
n = 18 (5.19%)
Threonine (Thr, T)
n = 45 (12.97%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.88%)
Leucine (Leu, L)
n = 55 (15.85%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 11 31 2 6 33 3 8 13 1 1 2 6 1 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 4 15 14 2 2 3 12 2 1 4 13 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 35 0 1 1 12 1 0 3 2 6 1 3 5 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 1 1 13 0 0 0 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 88 133 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 114 60 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 76 209 43
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 35 (10.09%)
Serine (Ser, S)
n = 18 (5.19%)
Threonine (Thr, T)
n = 45 (12.97%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.88%)
Leucine (Leu, L)
n = 55 (15.85%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 11 31 2 6 33 3 8 13 1 1 2 6 1 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 4 15 14 2 2 3 12 2 1 4 13 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 35 0 1 1 12 1 0 3 2 6 1 3 5 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 1 1 13 0 0 0 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 88 133 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 114 60 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 76 209 43
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 34 (7.41%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 39 (8.5%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 17 (3.7%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 43 (9.37%)
Methionine (Met, M)
n = 29 (6.32%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.83%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 17 25 8 12 37 7 19 11 0 2 3 11 1 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 4 3 15 16 0 4 6 17 2 4 2 17 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 1 7 4 12 0 2 3 8 7 1 3 2 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 2 2 3 12 1 0 1 10 1 0 0 0 0 19
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 121 142 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 120 79 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 119 233 84
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 5 2 2 9 1 4 2 0 0 0 3 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 7 3 0 0 3 1 0 0 1 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 2 3 3 1 1 1 0 1 1 2 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 1 0 1 0 1 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 25 21 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 32 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 32 40 20
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 52 (8.48%)
Serine (Ser, S)
n = 36 (5.87%)
Threonine (Thr, T)
n = 55 (8.97%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 30 (4.89%)
Leucine (Leu, L)
n = 86 (14.03%)
Isoleucine (Ile, I)
n = 51 (8.32%)
Methionine (Met, M)
n = 41 (6.69%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 41 (6.69%)
Tyrosine (Tyr, Y)
n = 13 (2.12%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 32 (5.22%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 13 (2.12%)
Lysine (Lys, K)
n = 26 (4.24%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 17 33 12 9 49 3 13 22 0 9 6 14 1 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 3 3 9 20 22 1 3 8 18 2 2 5 21 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 32 3 2 6 15 1 0 12 5 8 0 0 13 19 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 1 7 6 25 1 0 0 9 0 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
138 147 217 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 161 132 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 162 299 130
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 5 (2.89%)
Valine (Val, V)
n = 19 (10.98%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 10 (5.78%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 13 (7.51%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 1 2 7 0 1 1 11 0 0 10 0 4 5 12 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 5 0 11 2 3 0 10 0 4 11 2 0 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 2 1 3 0 12 1 1 8 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 3 3 2 0 0 4 0 1 1 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 19 20 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 30 25 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 9 35 96
Total protein-coding genes (size: 11468 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 246 (6.44%)
Alanine (Ala, A)
n = 322 (8.43%)
Serine (Ser, S)
n = 220 (5.76%)
Threonine (Thr, T)
n = 301 (7.88%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 235 (6.15%)
Leucine (Leu, L)
n = 590 (15.45%)
Isoleucine (Ile, I)
n = 279 (7.31%)
Methionine (Met, M)
n = 211 (5.53%)
Proline (Pro, P)
n = 214 (5.6%)
Phenylalanine (Phe, F)
n = 231 (6.05%)
Tyrosine (Tyr, Y)
n = 126 (3.3%)
Tryptophan (Trp, W)
n = 121 (3.17%)
Aspartic acid (Asp, D)
n = 81 (2.12%)
Glutamic acid (Glu, E)
n = 104 (2.72%)
Asparagine (Asn, N)
n = 132 (3.46%)
Glutamine (Gln, Q)
n = 100 (2.62%)
Histidine (His, H)
n = 99 (2.59%)
Lysine (Lys, K)
n = 94 (2.46%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
174 105 165 84 53 284 40 109 93 7 50 40 122 23 98 133
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 12 18 56 135 126 5 34 54 119 39 29 33 140 12 50
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
76 166 9 30 40 102 5 8 35 68 58 5 20 50 82 40
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
59 95 9 27 54 90 4 12 5 54 6 0 1 5 1 116
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
988 951 1061 820
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
518 1014 742 1546
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
232 980 1786 822

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.