Viewing data for Xenomystus nigri


Scientific name Xenomystus nigri
Common name African knifefish
Maximum lifespan 11.40 years (Xenomystus nigri@AnAge)

Total mtDNA (size: 16635 bases) GC AT G C A T
Base content (bases) 7527 9108 4862 2665 4060 5048
Base content per 1 kb (bases) 452 548 292 160 244 303
Base content (%) 45.2% 54.8%
Total protein-coding genes (size: 11400 bases) GC AT G C A T
Base content (bases) 5205 6195 3540 1665 2842 3353
Base content per 1 kb (bases) 457 543 311 146 249 294
Base content (%) 45.7% 54.3%
D-loop (size: 943 bases) GC AT G C A T
Base content (bases) 358 585 217 141 294 291
Base content per 1 kb (bases) 380 620 230 150 312 309
Base content (%) 38.0% 62.0%
Total tRNA-coding genes (size: 1554 bases) GC AT G C A T
Base content (bases) 688 866 392 296 387 479
Base content per 1 kb (bases) 443 557 252 190 249 308
Base content (%) 44.3% 55.7%
Total rRNA-coding genes (size: 2676 bases) GC AT G C A T
Base content (bases) 1245 1431 694 551 523 908
Base content per 1 kb (bases) 465 535 259 206 195 339
Base content (%) 46.5% 53.5%
12S rRNA gene (size: 978 bases) GC AT G C A T
Base content (bases) 477 501 270 207 186 315
Base content per 1 kb (bases) 488 512 276 212 190 322
Base content (%) 48.8% 51.2%
16S rRNA gene (size: 1698 bases) GC AT G C A T
Base content (bases) 768 930 424 344 337 593
Base content per 1 kb (bases) 452 548 250 203 198 349
Base content (%) 45.2% 54.8%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 302 381 217 85 189 192
Base content per 1 kb (bases) 442 558 318 124 277 281
Base content (%) 44.2% 55.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 54 15 39 60
Base content per 1 kb (bases) 411 589 321 89 232 357
Base content (%) 41.1% 58.9%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 742 806 453 289 408 398
Base content per 1 kb (bases) 479 521 293 187 264 257
Base content (%) 47.9% 52.1%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 293 395 188 105 178 217
Base content per 1 kb (bases) 426 574 273 153 259 315
Base content (%) 42.6% 57.4%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 376 410 245 131 196 214
Base content per 1 kb (bases) 478 522 312 167 249 272
Base content (%) 47.8% 52.2%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 518 623 350 168 307 316
Base content per 1 kb (bases) 454 546 307 147 269 277
Base content (%) 45.4% 54.6%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 440 535 298 142 252 283
Base content per 1 kb (bases) 451 549 306 146 258 290
Base content (%) 45.1% 54.9%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 462 583 343 119 238 345
Base content per 1 kb (bases) 442 558 328 114 228 330
Base content (%) 44.2% 55.8%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 164 182 110 54 96 86
Base content per 1 kb (bases) 474 526 318 156 277 249
Base content (%) 47.4% 52.6%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 639 742 433 206 347 395
Base content per 1 kb (bases) 463 537 314 149 251 286
Base content (%) 46.3% 53.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 142 155 95 47 83 72
Base content per 1 kb (bases) 478 522 320 158 279 242
Base content (%) 47.8% 52.2%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 809 1033 567 242 453 580
Base content per 1 kb (bases) 439 561 308 131 246 315
Base content (%) 43.9% 56.1%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 255 267 191 64 62 205
Base content per 1 kb (bases) 489 511 366 123 119 393
Base content (%) 48.9% 51.1%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.54%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 16 (7.08%)
Leucine (Leu, L)
n = 49 (21.68%)
Isoleucine (Ile, I)
n = 19 (8.41%)
Methionine (Met, M)
n = 9 (3.98%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 14 (6.19%)
Tyrosine (Tyr, Y)
n = 6 (2.65%)
Tryptophan (Trp, W)
n = 4 (1.77%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 6 (2.65%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 3 (1.33%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 6 4 11 20 4 9 6 2 2 4 10 0 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 2 11 4 0 1 3 3 1 2 5 5 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 1 0 5 3 0 0 5 3 3 0 1 2 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 1 2 1 0 2 2 1 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 72 66 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 63 34 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 82 91 38
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWLLILLFSWFVLLVMIPPKIMSHHLTDEPTHQTTKKHDSTNWTWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 2 (3.64%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 5 (9.09%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 2 1 2 2 1 2 2 0 0 0 2 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 0 0 0 0 0 0 2 1 3 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 0 0 0 2 0 0 1 0 0 0 0 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 0 0 2 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 20 18 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 16 16 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 18 26 9
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 50 (9.71%)
Alanine (Ala, A)
n = 46 (8.93%)
Serine (Ser, S)
n = 29 (5.63%)
Threonine (Thr, T)
n = 36 (6.99%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.18%)
Leucine (Leu, L)
n = 61 (11.84%)
Isoleucine (Ile, I)
n = 39 (7.57%)
Methionine (Met, M)
n = 27 (5.24%)
Proline (Pro, P)
n = 28 (5.44%)
Phenylalanine (Phe, F)
n = 43 (8.35%)
Tyrosine (Tyr, Y)
n = 19 (3.69%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 12 (2.33%)
Asparagine (Asn, N)
n = 14 (2.72%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 19 17 11 16 21 6 6 5 2 4 15 11 7 15 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 6 26 13 1 2 16 20 12 5 2 16 5 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 1 2 13 9 1 0 4 7 12 3 1 3 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 12 0 3 11 9 0 1 1 5 1 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
159 115 129 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 135 94 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 203 175 88
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 17 (7.46%)
Serine (Ser, S)
n = 15 (6.58%)
Threonine (Thr, T)
n = 15 (6.58%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 16 (7.02%)
Leucine (Leu, L)
n = 27 (11.84%)
Isoleucine (Ile, I)
n = 22 (9.65%)
Methionine (Met, M)
n = 9 (3.95%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 11 (4.82%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 12 (5.26%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 6 (2.63%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 9 6 3 4 11 1 6 8 0 3 4 6 3 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 2 7 8 0 1 3 3 1 2 3 7 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 8 0 1 5 6 0 1 2 3 8 0 2 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 2 4 8 6 0 1 3 1 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 57 60 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 58 65 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 73 92 49
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 26 (9.96%)
Serine (Ser, S)
n = 15 (5.75%)
Threonine (Thr, T)
n = 20 (7.66%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 17 (6.51%)
Leucine (Leu, L)
n = 32 (12.26%)
Isoleucine (Ile, I)
n = 13 (4.98%)
Methionine (Met, M)
n = 7 (2.68%)
Proline (Pro, P)
n = 13 (4.98%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 9 5 4 3 18 2 4 7 0 2 8 7 0 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 4 9 12 1 0 10 10 1 3 4 3 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 2 6 4 0 0 3 3 9 0 1 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 0 0 4 3 0 1 0 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 68 49 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 71 55 92
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 106 110 36
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 22 (5.8%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 24 (6.33%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 33 (8.71%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 32 (8.44%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 8 (2.11%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 18 12 3 12 31 4 8 6 0 3 11 8 2 9 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 12 15 0 2 12 10 1 1 8 10 3 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 8 1 3 6 11 1 0 3 6 8 3 1 6 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 2 2 9 7 1 0 1 5 2 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 98 97 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 93 75 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 159 144 54
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 32 (9.88%)
Serine (Ser, S)
n = 22 (6.79%)
Threonine (Thr, T)
n = 22 (6.79%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.63%)
Leucine (Leu, L)
n = 60 (18.52%)
Isoleucine (Ile, I)
n = 23 (7.1%)
Methionine (Met, M)
n = 15 (4.63%)
Proline (Pro, P)
n = 25 (7.72%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 9 (2.78%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 8 (2.47%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 14 11 7 15 21 8 8 8 0 2 3 9 1 10 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 6 15 10 1 0 8 8 2 1 5 15 4 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 2 5 13 0 0 2 8 5 1 1 5 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 1 3 7 0 1 2 4 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 94 82 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 99 59 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 105 142 53
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 40 (11.53%)
Serine (Ser, S)
n = 19 (5.48%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 64 (18.44%)
Isoleucine (Ile, I)
n = 26 (7.49%)
Methionine (Met, M)
n = 27 (7.78%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 10 26 7 15 30 3 9 11 1 1 2 3 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 10 18 11 1 0 8 7 1 1 5 12 3 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 17 0 2 5 6 0 0 6 1 6 1 0 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 2 12 0 0 1 2 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 98 129 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 121 55 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 124 161 51
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 40 (11.53%)
Serine (Ser, S)
n = 19 (5.48%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 64 (18.44%)
Isoleucine (Ile, I)
n = 26 (7.49%)
Methionine (Met, M)
n = 27 (7.78%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 10 26 7 15 30 3 9 11 1 1 2 3 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 10 18 11 1 0 8 7 1 1 5 12 3 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 17 0 2 5 6 0 0 6 1 6 1 0 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 2 12 0 0 1 2 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 98 129 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 121 55 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 124 161 51
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.66%)
Alanine (Ala, A)
n = 36 (7.84%)
Serine (Ser, S)
n = 29 (6.32%)
Threonine (Thr, T)
n = 45 (9.8%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 18 (3.92%)
Leucine (Leu, L)
n = 89 (19.39%)
Isoleucine (Ile, I)
n = 38 (8.28%)
Methionine (Met, M)
n = 27 (5.88%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 18 (3.92%)
Aspartic acid (Asp, D)
n = 7 (1.53%)
Glutamic acid (Glu, E)
n = 8 (1.74%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 14 (3.05%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 12 (2.61%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 19 21 12 26 28 7 16 10 4 3 4 6 5 5 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 4 5 19 11 1 1 12 8 5 4 10 9 3 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 17 5 4 5 10 4 2 4 2 13 2 0 4 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 1 1 6 10 2 0 1 8 1 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 135 139 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 130 79 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 168 177 69
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 27 (27.55%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 3 7 5 7 3 5 4 0 0 0 0 1 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 1 7 5 0 2 3 1 0 0 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 0 0 2 3 1 1 3 0 1 0 0 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 32 21 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 28 13 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 35 38 18
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 51 (8.32%)
Serine (Ser, S)
n = 43 (7.01%)
Threonine (Thr, T)
n = 68 (11.09%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 28 (4.57%)
Leucine (Leu, L)
n = 89 (14.52%)
Isoleucine (Ile, I)
n = 48 (7.83%)
Methionine (Met, M)
n = 35 (5.71%)
Proline (Pro, P)
n = 28 (4.57%)
Phenylalanine (Phe, F)
n = 42 (6.85%)
Tyrosine (Tyr, Y)
n = 10 (1.63%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 15 (2.45%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 30 (4.89%)
Glutamine (Gln, Q)
n = 19 (3.1%)
Histidine (His, H)
n = 12 (1.96%)
Lysine (Lys, K)
n = 23 (3.75%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 24 29 13 18 44 6 7 18 1 9 8 11 0 13 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 6 8 20 20 3 3 11 13 4 1 11 12 4 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 26 3 5 16 10 0 2 10 3 7 2 1 7 23 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 2 2 13 23 0 1 1 6 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
137 149 216 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 178 122 242
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 240 242 99
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 23 (13.29%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 8 (4.62%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 2 5 0 2 0 8 0 0 11 1 4 7 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 7 2 3 5 6 2 0 19 3 0 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 7 1 0 1 1 2 7 2 4 16 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 7 2 0 0 0 1 1 0 3 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 16 20 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 35 20 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
70 13 22 69
Total protein-coding genes (size: 11422 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 241 (6.34%)
Alanine (Ala, A)
n = 332 (8.73%)
Serine (Ser, S)
n = 242 (6.36%)
Threonine (Thr, T)
n = 327 (8.6%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 206 (5.42%)
Leucine (Leu, L)
n = 624 (16.4%)
Isoleucine (Ile, I)
n = 280 (7.36%)
Methionine (Met, M)
n = 189 (4.97%)
Proline (Pro, P)
n = 211 (5.55%)
Phenylalanine (Phe, F)
n = 230 (6.05%)
Tyrosine (Tyr, Y)
n = 120 (3.15%)
Tryptophan (Trp, W)
n = 118 (3.1%)
Aspartic acid (Asp, D)
n = 77 (2.02%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 117 (3.08%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 87 (2.29%)
Arginine (Arg, R)
n = 72 (1.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
141 139 141 80 133 248 50 89 86 12 41 60 78 27 91 139
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
48 6 22 54 149 116 13 18 92 84 47 26 55 97 33 42
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
137 134 14 30 73 78 8 7 46 45 75 17 24 34 83 16
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
86 81 16 15 62 83 4 6 13 39 14 0 1 6 0 101
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
953 994 1054 804
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
513 1059 704 1529
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
328 1364 1461 652

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.