Viewing data for Barbatula barbatula


Scientific name Barbatula barbatula
Common name Stone loach
Maximum lifespan 7.00 years (Barbatula barbatula@AnAge)

Total mtDNA (size: 16630 bases) GC AT G C A T
Base content (bases) 7543 9087 4515 3028 4353 4734
Base content per 1 kb (bases) 454 546 271 182 262 285
Base content (%) 45.4% 54.6%
Total protein-coding genes (size: 11408 bases) GC AT G C A T
Base content (bases) 5263 6145 3288 1975 3082 3063
Base content per 1 kb (bases) 461 539 288 173 270 268
Base content (%) 46.1% 53.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1553 bases) GC AT G C A T
Base content (bases) 699 854 380 319 395 459
Base content per 1 kb (bases) 450 550 245 205 254 296
Base content (%) 45.0% 55.0%
Total rRNA-coding genes (size: 2628 bases) GC AT G C A T
Base content (bases) 1223 1405 643 580 539 866
Base content per 1 kb (bases) 465 535 245 221 205 330
Base content (%) 46.5% 53.5%
12S rRNA gene (size: 950 bases) GC AT G C A T
Base content (bases) 473 477 257 216 186 291
Base content per 1 kb (bases) 498 502 271 227 196 306
Base content (%) 49.8% 50.2%
16S rRNA gene (size: 1678 bases) GC AT G C A T
Base content (bases) 750 928 386 364 353 575
Base content per 1 kb (bases) 447 553 230 217 210 343
Base content (%) 44.7% 55.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 292 392 189 103 198 194
Base content per 1 kb (bases) 427 573 276 151 289 284
Base content (%) 42.7% 57.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 47 25 40 56
Base content per 1 kb (bases) 429 571 280 149 238 333
Base content (%) 42.9% 57.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 723 828 427 296 451 377
Base content per 1 kb (bases) 466 534 275 191 291 243
Base content (%) 46.6% 53.4%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 300 391 182 118 185 206
Base content per 1 kb (bases) 434 566 263 171 268 298
Base content (%) 43.4% 56.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 374 410 227 147 209 201
Base content per 1 kb (bases) 477 523 290 188 267 256
Base content (%) 47.7% 52.3%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 528 613 331 197 319 294
Base content per 1 kb (bases) 463 537 290 173 280 258
Base content (%) 46.3% 53.7%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 467 508 289 178 267 241
Base content per 1 kb (bases) 479 521 296 183 274 247
Base content (%) 47.9% 52.1%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 503 542 324 179 262 280
Base content per 1 kb (bases) 481 519 310 171 251 268
Base content (%) 48.1% 51.9%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 164 187 106 58 99 88
Base content per 1 kb (bases) 467 533 302 165 282 251
Base content (%) 46.7% 53.3%
ND4 (size: 1382 bases) GC AT G C A T
Base content (bases) 624 758 387 237 386 372
Base content per 1 kb (bases) 452 548 280 171 279 269
Base content (%) 45.2% 54.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 141 156 91 50 84 72
Base content per 1 kb (bases) 475 525 306 168 283 242
Base content (%) 47.5% 52.5%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 831 1008 526 305 512 496
Base content per 1 kb (bases) 452 548 286 166 278 270
Base content (%) 45.2% 54.8%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 250 272 164 86 76 196
Base content per 1 kb (bases) 479 521 314 165 146 375
Base content (%) 47.9% 52.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 21 (9.25%)
Serine (Ser, S)
n = 9 (3.96%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 17 (7.49%)
Leucine (Leu, L)
n = 48 (21.15%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 4 7 4 10 19 4 10 7 1 5 1 9 2 8 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 8 7 3 2 2 4 3 2 6 6 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 1 2 1 1 0 1 4 2 3 0 1 3 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 0 1 1 0 0 2 3 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 70 67 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 62 32 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 57 95 54
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLVFLTIIPTKVMSHTTPNEPAHLDAEKHKTEPWDWPWQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 4 (7.27%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 2 (3.64%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 3 (5.45%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 1 1 0 0 0 2 2 0 0 0 3 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 2 1 0 0 0 0 0 1 3 3 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 0 0 1 0 1 0 0 0 1 2 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 2 1 1 3 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
12 14 16 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 18 16 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 15 24 10
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.72%)
Alanine (Ala, A)
n = 48 (9.3%)
Serine (Ser, S)
n = 33 (6.4%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.33%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 37 (7.17%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 17 12 16 8 17 8 8 6 1 9 11 18 5 16 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 8 25 12 3 10 11 14 10 5 14 8 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 21 3 6 9 12 0 2 4 8 10 7 6 7 7 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 3 4 10 8 0 2 1 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
161 112 124 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 140 92 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
57 175 161 124
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 17 (7.42%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 6 (2.62%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 12 9 5 8 2 4 5 3 3 4 9 4 6 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 2 5 8 1 2 0 3 4 1 7 5 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 7 0 3 5 6 0 1 2 7 2 1 0 0 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 12 3 3 9 3 1 1 2 3 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 62 53 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 64 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 66 89 54
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (8.85%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 3 6 6 6 11 3 5 6 3 2 5 8 2 11 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 1 12 6 2 1 9 10 3 2 2 8 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 2 2 7 3 0 0 3 3 9 4 2 0 1 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 2 2 3 2 0 0 3 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 68 49 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 66 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 93 97 45
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 31 (8.18%)
Serine (Ser, S)
n = 20 (5.28%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 25 (6.6%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 29 (7.65%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 8 (2.11%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 19 6 9 9 23 5 8 6 1 3 7 11 4 11 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 3 5 13 9 4 2 7 11 7 3 6 11 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 8 3 3 9 7 1 0 0 10 4 1 4 4 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 2 5 2 8 8 0 0 1 5 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 95 92 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 97 75 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 139 127 68
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 33 (10.19%)
Serine (Ser, S)
n = 20 (6.17%)
Threonine (Thr, T)
n = 21 (6.48%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (5.56%)
Leucine (Leu, L)
n = 66 (20.37%)
Isoleucine (Ile, I)
n = 21 (6.48%)
Methionine (Met, M)
n = 12 (3.7%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 16 (4.94%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 8 (2.47%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 12 7 12 9 17 13 9 5 3 2 9 3 4 9 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 4 16 10 3 2 6 3 7 2 10 11 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 1 4 4 7 3 0 2 9 3 3 6 6 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 3 2 2 5 2 0 0 4 4 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 95 76 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 96 60 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 98 105 64
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 48 (13.83%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 42 (12.1%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 14 (4.03%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 21 (6.05%)
Methionine (Met, M)
n = 20 (5.76%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 7 10 14 12 18 9 11 8 4 3 2 6 3 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 0 4 23 16 5 3 5 4 5 4 6 7 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 0 1 6 7 2 2 2 3 6 3 5 3 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 1 1 2 6 3 0 0 2 3 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 96 104 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 125 52 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 103 124 66
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 48 (13.83%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 42 (12.1%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 14 (4.03%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 21 (6.05%)
Methionine (Met, M)
n = 20 (5.76%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 7 10 14 12 18 9 11 8 4 3 2 6 3 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 0 4 23 16 5 3 5 4 5 4 6 7 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 0 1 6 7 2 2 2 3 6 3 5 3 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 1 1 2 6 3 0 0 2 3 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 96 104 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 125 52 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 103 124 66
ND4 (size: 1382 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 37 (8.06%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 43 (9.37%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 85 (18.52%)
Isoleucine (Ile, I)
n = 38 (8.28%)
Methionine (Met, M)
n = 29 (6.32%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 13 (2.83%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 13 16 12 17 23 11 16 10 3 5 2 6 3 12 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 3 2 0 20 15 2 5 9 7 8 3 14 6 5 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 15 4 8 4 9 0 1 6 10 4 7 6 7 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 3 0 3 8 2 0 3 6 2 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 126 139 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 129 74 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
69 132 158 101
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 5 2 4 11 3 3 3 0 1 0 2 0 6 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 3 6 3 0 1 3 1 1 0 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 1 1 2 3 0 1 2 0 0 0 0 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 0 0 0 1 1 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 32 20 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 28 13 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 31 39 20
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.23%)
Alanine (Ala, A)
n = 55 (8.99%)
Serine (Ser, S)
n = 44 (7.19%)
Threonine (Thr, T)
n = 63 (10.29%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 36 (5.88%)
Leucine (Leu, L)
n = 96 (15.69%)
Isoleucine (Ile, I)
n = 49 (8.01%)
Methionine (Met, M)
n = 28 (4.58%)
Proline (Pro, P)
n = 28 (4.58%)
Phenylalanine (Phe, F)
n = 38 (6.21%)
Tyrosine (Tyr, Y)
n = 11 (1.8%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 14 (2.29%)
Glutamic acid (Glu, E)
n = 13 (2.12%)
Asparagine (Asn, N)
n = 24 (3.92%)
Glutamine (Gln, Q)
n = 18 (2.94%)
Histidine (His, H)
n = 13 (2.12%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 14 15 14 16 32 15 12 8 10 11 10 8 7 20 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 4 2 9 25 19 2 9 10 8 5 3 14 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 22 3 7 12 10 1 6 8 2 9 5 7 9 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 7 5 9 18 2 3 0 6 1 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 146 198 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 176 114 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
79 204 184 146
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.72%)
Alanine (Ala, A)
n = 21 (12.14%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 6 (3.47%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 23 (13.29%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 3 4 1 5 4 8 0 0 5 5 5 8 9 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 11 3 5 2 6 2 2 12 3 0 1 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 5 0 2 1 2 2 7 1 4 9 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 4 3 0 0 1 2 2 0 1 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 25 21 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 40 21 74
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 21 34 69
Total protein-coding genes (size: 11430 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 246 (6.46%)
Alanine (Ala, A)
n = 356 (9.35%)
Serine (Ser, S)
n = 235 (6.17%)
Threonine (Thr, T)
n = 312 (8.2%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 238 (6.25%)
Leucine (Leu, L)
n = 631 (16.57%)
Isoleucine (Ile, I)
n = 263 (6.91%)
Methionine (Met, M)
n = 174 (4.57%)
Proline (Pro, P)
n = 213 (5.59%)
Phenylalanine (Phe, F)
n = 227 (5.96%)
Tyrosine (Tyr, Y)
n = 114 (2.99%)
Tryptophan (Trp, W)
n = 121 (3.18%)
Aspartic acid (Asp, D)
n = 76 (2.0%)
Glutamic acid (Glu, E)
n = 104 (2.73%)
Asparagine (Asn, N)
n = 108 (2.84%)
Glutamine (Gln, Q)
n = 98 (2.57%)
Histidine (His, H)
n = 105 (2.76%)
Lysine (Lys, K)
n = 74 (1.94%)
Arginine (Arg, R)
n = 78 (2.05%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
160 103 102 105 103 192 80 103 69 29 49 57 89 43 117 110
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
72 13 14 52 162 115 27 43 67 69 67 31 88 78 16 46
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
111 136 19 44 60 70 8 17 36 61 53 36 48 42 66 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
77 67 37 24 52 62 12 8 16 39 15 0 0 5 3 85
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1020 974 984 830
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
525 1063 687 1533
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
512 1175 1281 840

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.