Viewing data for Alepocephalus bairdii


Scientific name Alepocephalus bairdii
Common name Baird's smoothhead
Maximum lifespan 38.00 years (Alepocephalus bairdii@AnAge)

Total mtDNA (size: 16637 bases) GC AT G C A T
Base content (bases) 8003 8634 5218 2785 3942 4692
Base content per 1 kb (bases) 481 519 314 167 237 282
Base content (%) 48.1% 51.9%
Total protein-coding genes (size: 11414 bases) GC AT G C A T
Base content (bases) 5564 5850 3834 1730 2791 3059
Base content per 1 kb (bases) 487 513 336 152 245 268
Base content (%) 48.7% 51.3%
D-loop (size: 989 bases) GC AT G C A T
Base content (bases) 384 605 226 158 298 307
Base content per 1 kb (bases) 388 612 229 160 301 310
Base content (%) 38.8% 61.2%
Total tRNA-coding genes (size: 1551 bases) GC AT G C A T
Base content (bases) 727 824 422 305 348 476
Base content per 1 kb (bases) 469 531 272 197 224 307
Base content (%) 46.9% 53.1%
Total rRNA-coding genes (size: 2626 bases) GC AT G C A T
Base content (bases) 1296 1330 716 580 493 837
Base content per 1 kb (bases) 494 506 273 221 188 319
Base content (%) 49.4% 50.6%
12S rRNA gene (size: 951 bases) GC AT G C A T
Base content (bases) 488 463 267 221 184 279
Base content per 1 kb (bases) 513 487 281 232 193 293
Base content (%) 51.3% 48.7%
16S rRNA gene (size: 1675 bases) GC AT G C A T
Base content (bases) 808 867 449 359 309 558
Base content per 1 kb (bases) 482 518 268 214 184 333
Base content (%) 48.2% 51.8%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 331 352 237 94 179 173
Base content per 1 kb (bases) 485 515 347 138 262 253
Base content (%) 48.5% 51.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 75 93 55 20 41 52
Base content per 1 kb (bases) 446 554 327 119 244 310
Base content (%) 44.6% 55.4%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 774 780 475 299 417 363
Base content per 1 kb (bases) 498 502 306 192 268 234
Base content (%) 49.8% 50.2%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 321 370 211 110 170 200
Base content per 1 kb (bases) 465 535 305 159 246 289
Base content (%) 46.5% 53.5%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 388 397 252 136 203 194
Base content per 1 kb (bases) 494 506 321 173 259 247
Base content (%) 49.4% 50.6%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 567 574 394 173 288 286
Base content per 1 kb (bases) 497 503 345 152 252 251
Base content (%) 49.7% 50.3%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 502 473 356 146 231 242
Base content per 1 kb (bases) 515 485 365 150 237 248
Base content (%) 51.5% 48.5%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 512 533 379 133 222 311
Base content per 1 kb (bases) 490 510 363 127 212 298
Base content (%) 49.0% 51.0%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 164 185 115 49 99 86
Base content per 1 kb (bases) 470 530 330 140 284 246
Base content (%) 47.0% 53.0%
ND4 (size: 1386 bases) GC AT G C A T
Base content (bases) 661 725 456 205 353 372
Base content per 1 kb (bases) 477 523 329 148 255 268
Base content (%) 47.7% 52.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 150 147 101 49 72 75
Base content per 1 kb (bases) 505 495 340 165 242 253
Base content (%) 50.5% 49.5%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 864 975 614 250 458 517
Base content per 1 kb (bases) 470 530 334 136 249 281
Base content (%) 47.0% 53.0%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 260 262 192 68 64 198
Base content per 1 kb (bases) 498 502 368 130 123 379
Base content (%) 49.8% 50.2%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 20 (8.85%)
Serine (Ser, S)
n = 7 (3.1%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.19%)
Leucine (Leu, L)
n = 56 (24.78%)
Isoleucine (Ile, I)
n = 15 (6.64%)
Methionine (Met, M)
n = 10 (4.42%)
Proline (Pro, P)
n = 17 (7.52%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 6 5 18 21 6 4 5 4 2 7 5 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 10 6 0 2 3 5 1 2 9 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 1 2 0 0 1 3 2 3 0 2 4 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 1 1 0 2 1 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 85 62 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 63 32 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 89 78 42
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLVFLTVIPPKVLGHTFTNEPTALSTEKTKPEPWTWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (7.27%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 0 1 0 3 1 1 1 0 1 0 3 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 2 1 0 1 0 0 0 1 6 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 1 0 0 0 0 1 0 0 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
11 17 16 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 20 12 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 18 24 12
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.9%)
Alanine (Ala, A)
n = 45 (8.7%)
Serine (Ser, S)
n = 33 (6.38%)
Threonine (Thr, T)
n = 36 (6.96%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.51%)
Leucine (Leu, L)
n = 66 (12.77%)
Isoleucine (Ile, I)
n = 34 (6.58%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 18 (3.48%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 16 14 11 22 15 13 4 7 2 6 15 18 5 15 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 0 1 7 28 9 1 6 15 15 10 3 14 8 3 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 14 5 6 11 10 1 2 3 7 11 4 1 3 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 8 3 3 11 7 1 2 1 4 1 1 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
160 125 123 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 93 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
61 213 147 97
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.49%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 18 (7.86%)
Threonine (Thr, T)
n = 11 (4.8%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 17 (7.42%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 20 (8.73%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 15 9 9 8 5 2 4 6 2 4 4 7 2 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 1 7 4 4 0 3 5 0 1 9 4 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 0 1 5 8 0 0 4 3 6 1 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 14 1 2 11 3 1 0 3 3 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 62 56 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 64 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 94 80 40
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 19 (7.31%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 11 4 5 10 11 2 3 8 0 3 7 5 2 12 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 4 9 6 0 1 8 10 3 1 9 2 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 0 2 4 6 0 0 3 1 10 0 3 0 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 4 0 5 2 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 70 51 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 67 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 115 88 40
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 32 (8.44%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 27 (7.12%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 26 (6.86%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 28 (7.39%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 14 (3.69%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 20 6 13 16 21 3 3 4 2 2 14 8 2 9 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 17 14 0 2 11 8 3 2 12 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 8 2 1 15 3 1 0 2 0 16 1 2 5 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 2 8 7 2 0 0 7 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 102 92 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 101 78 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 191 116 50
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 36 (11.11%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 19 (5.86%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (5.56%)
Leucine (Leu, L)
n = 65 (20.06%)
Isoleucine (Ile, I)
n = 24 (7.41%)
Methionine (Met, M)
n = 8 (2.47%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 13 4 5 25 24 5 5 6 1 1 7 9 1 4 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 21 10 0 2 8 4 4 1 14 7 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 1 1 11 6 0 0 3 4 9 1 1 0 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 2 0 4 7 0 0 3 5 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 102 72 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 97 58 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 157 112 34
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 46 (13.26%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 40 (11.53%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 73 (21.04%)
Isoleucine (Ile, I)
n = 19 (5.48%)
Methionine (Met, M)
n = 20 (5.76%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 9 (2.59%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 17 17 8 17 34 5 9 11 1 3 3 5 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 6 23 17 0 0 8 10 0 2 12 6 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 13 0 1 7 7 1 0 4 0 7 1 0 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 0 2 8 1 3 0 1 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 110 103 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 123 55 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 146 153 36
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 46 (13.26%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 40 (11.53%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 73 (21.04%)
Isoleucine (Ile, I)
n = 19 (5.48%)
Methionine (Met, M)
n = 20 (5.76%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 9 (2.59%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 17 17 8 17 34 5 9 11 1 3 3 5 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 6 23 17 0 0 8 10 0 2 12 6 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 13 0 1 7 7 1 0 4 0 7 1 0 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 0 2 8 1 3 0 1 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 110 103 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 123 55 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 146 153 36
ND4 (size: 1386 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.29%)
Alanine (Ala, A)
n = 35 (7.59%)
Serine (Ser, S)
n = 35 (7.59%)
Threonine (Thr, T)
n = 41 (8.89%)
Cysteine (Cys, C)
n = 6 (1.3%)
Valine (Val, V)
n = 15 (3.25%)
Leucine (Leu, L)
n = 88 (19.09%)
Isoleucine (Ile, I)
n = 37 (8.03%)
Methionine (Met, M)
n = 28 (6.07%)
Proline (Pro, P)
n = 27 (5.86%)
Phenylalanine (Phe, F)
n = 16 (3.47%)
Tyrosine (Tyr, Y)
n = 14 (3.04%)
Tryptophan (Trp, W)
n = 20 (4.34%)
Aspartic acid (Asp, D)
n = 5 (1.08%)
Glutamic acid (Glu, E)
n = 11 (2.39%)
Asparagine (Asn, N)
n = 10 (2.17%)
Glutamine (Gln, Q)
n = 12 (2.6%)
Histidine (His, H)
n = 11 (2.39%)
Lysine (Lys, K)
n = 10 (2.17%)
Arginine (Arg, R)
n = 11 (2.39%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 25 20 16 29 26 9 8 10 2 3 5 7 0 6 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 3 3 7 18 9 1 1 12 11 5 6 13 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 19 3 4 17 6 0 2 6 3 11 3 0 3 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 1 2 3 8 2 3 3 4 1 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 141 135 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 130 73 184
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 185 164 78
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 14 (14.29%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 3 4 5 10 1 4 3 0 1 0 0 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 7 6 0 0 1 3 2 0 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 1 0 2 5 0 0 4 0 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 1 0 0 0 0 2 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 32 19 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 30 14 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 39 42 11
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.39%)
Alanine (Ala, A)
n = 59 (9.64%)
Serine (Ser, S)
n = 40 (6.54%)
Threonine (Thr, T)
n = 62 (10.13%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 28 (4.58%)
Leucine (Leu, L)
n = 90 (14.71%)
Isoleucine (Ile, I)
n = 50 (8.17%)
Methionine (Met, M)
n = 29 (4.74%)
Proline (Pro, P)
n = 29 (4.74%)
Phenylalanine (Phe, F)
n = 43 (7.03%)
Tyrosine (Tyr, Y)
n = 11 (1.8%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 15 (2.45%)
Glutamic acid (Glu, E)
n = 11 (1.8%)
Asparagine (Asn, N)
n = 29 (4.74%)
Glutamine (Gln, Q)
n = 21 (3.43%)
Histidine (His, H)
n = 13 (2.12%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 34 20 15 29 31 5 9 20 1 7 12 8 1 18 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 4 6 37 16 0 3 15 10 5 3 16 10 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
39 14 1 5 14 9 0 7 5 4 7 4 1 7 22 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 1 4 11 20 0 1 1 6 2 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 153 202 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 178 121 240
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 283 194 106
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.87%)
Alanine (Ala, A)
n = 19 (10.98%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 28 (16.18%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 0 5 0 2 2 6 0 0 7 0 2 19 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 9 5 0 5 3 2 1 18 3 1 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 1 0 4 3 3 0 5 3 2 12 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 4 2 1 1 0 1 0 1 3 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 19 18 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 36 21 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
72 13 25 64
Total protein-coding genes (size: 11435 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 246 (6.46%)
Alanine (Ala, A)
n = 353 (9.27%)
Serine (Ser, S)
n = 240 (6.3%)
Threonine (Thr, T)
n = 312 (8.19%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 225 (5.91%)
Leucine (Leu, L)
n = 644 (16.91%)
Isoleucine (Ile, I)
n = 259 (6.8%)
Methionine (Met, M)
n = 160 (4.2%)
Proline (Pro, P)
n = 218 (5.72%)
Phenylalanine (Phe, F)
n = 231 (6.07%)
Tyrosine (Tyr, Y)
n = 115 (3.02%)
Tryptophan (Trp, W)
n = 123 (3.23%)
Aspartic acid (Asp, D)
n = 77 (2.02%)
Glutamic acid (Glu, E)
n = 103 (2.7%)
Asparagine (Asn, N)
n = 114 (2.99%)
Glutamine (Gln, Q)
n = 99 (2.6%)
Histidine (His, H)
n = 105 (2.76%)
Lysine (Lys, K)
n = 75 (1.97%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
92 167 104 100 187 215 56 63 84 15 40 75 78 32 98 133
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
56 9 18 53 188 101 11 22 88 84 52 27 121 62 8 47
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
145 106 14 26 90 65 6 15 38 29 86 18 23 27 87 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
88 84 19 17 60 68 7 13 16 39 8 2 0 5 0 105
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1004 1056 975 774
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
527 1070 693 1519
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
325 1587 1265 632

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.