Viewing data for Chrysemys picta


Scientific name Chrysemys picta
Common name Painted turtle
Maximum lifespan 61.00 years (Chrysemys picta@AnAge)

Total mtDNA (size: 16866 bases) GC AT G C A T
Base content (bases) 6541 10325 4376 2165 4515 5810
Base content per 1 kb (bases) 388 612 259 128 268 344
Base content (%) 38.8% 61.2%
Total protein-coding genes (size: 11365 bases) GC AT G C A T
Base content (bases) 4509 6856 3185 1324 3048 3808
Base content per 1 kb (bases) 397 603 280 116 268 335
Base content (%) 39.7% 60.3%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1548 bases) GC AT G C A T
Base content (bases) 583 965 340 243 426 539
Base content per 1 kb (bases) 377 623 220 157 275 348
Base content (%) 37.7% 62.3%
Total rRNA-coding genes (size: 2583 bases) GC AT G C A T
Base content (bases) 1020 1563 590 430 552 1011
Base content per 1 kb (bases) 395 605 228 166 214 391
Base content (%) 39.5% 60.5%
12S rRNA gene (size: 969 bases) GC AT G C A T
Base content (bases) 397 572 232 165 206 366
Base content per 1 kb (bases) 410 590 239 170 213 378
Base content (%) 41.0% 59.0%
16S rRNA gene (size: 1614 bases) GC AT G C A T
Base content (bases) 623 991 358 265 346 645
Base content per 1 kb (bases) 386 614 222 164 214 400
Base content (%) 38.6% 61.4%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 279 405 206 73 181 224
Base content per 1 kb (bases) 408 592 301 107 265 327
Base content (%) 40.8% 59.2%
ATP8 (size: 189 bases) GC AT G C A T
Base content (bases) 64 125 53 11 50 75
Base content per 1 kb (bases) 339 661 280 58 265 397
Base content (%) 33.9% 66.1%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 632 916 379 253 458 458
Base content per 1 kb (bases) 408 592 245 163 296 296
Base content (%) 40.8% 59.2%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 266 421 175 91 182 239
Base content per 1 kb (bases) 387 613 255 132 265 348
Base content (%) 38.7% 61.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 328 456 211 117 221 235
Base content per 1 kb (bases) 418 582 269 149 282 300
Base content (%) 41.8% 58.2%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 478 662 350 128 309 353
Base content per 1 kb (bases) 419 581 307 112 271 310
Base content (%) 41.9% 58.1%
ND1 (size: 971 bases) GC AT G C A T
Base content (bases) 373 598 271 102 280 318
Base content per 1 kb (bases) 384 616 279 105 288 327
Base content (%) 38.4% 61.6%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 396 643 314 82 248 395
Base content per 1 kb (bases) 381 619 302 79 239 380
Base content (%) 38.1% 61.9%
ND3 (size: 350 bases) GC AT G C A T
Base content (bases) 136 214 91 45 105 109
Base content per 1 kb (bases) 389 611 260 129 300 311
Base content (%) 38.9% 61.1%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 544 837 399 145 356 481
Base content per 1 kb (bases) 394 606 289 105 258 348
Base content (%) 39.4% 60.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 112 185 81 31 93 92
Base content per 1 kb (bases) 377 623 273 104 313 310
Base content (%) 37.7% 62.3%
ND5 (size: 1809 bases) GC AT G C A T
Base content (bases) 700 1109 493 207 502 607
Base content per 1 kb (bases) 387 613 273 114 278 336
Base content (%) 38.7% 61.3%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 214 311 171 43 74 237
Base content per 1 kb (bases) 408 592 326 82 141 451
Base content (%) 40.8% 59.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 31 (13.66%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 11 (4.85%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 12 8 10 13 5 14 11 0 1 0 4 3 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 7 4 0 3 2 4 0 1 1 14 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 0 2 3 3 1 0 4 0 3 1 3 4 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 1 0 3 0 0 1 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 71 80 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 69 36 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 66 108 38
ATP8 (size: 189 bases)
Amino acid sequence: MPQLNTDPWFMILSSSWLMYILILQPKISSYLPTNDPTNKNNKTMHTNSWTWPWTQHSSINS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 9 (14.52%)
Threonine (Thr, T)
n = 7 (11.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 6 (9.68%)
Isoleucine (Ile, I)
n = 5 (8.06%)
Methionine (Met, M)
n = 4 (6.45%)
Proline (Pro, P)
n = 6 (9.68%)
Phenylalanine (Phe, F)
n = 1 (1.61%)
Tyrosine (Tyr, Y)
n = 2 (3.23%)
Tryptophan (Trp, W)
n = 5 (8.06%)
Aspartic acid (Asp, D)
n = 2 (3.23%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 7 (11.29%)
Glutamine (Gln, Q)
n = 3 (4.84%)
Histidine (His, H)
n = 2 (3.23%)
Lysine (Lys, K)
n = 3 (4.84%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 3 2 0 0 0 4 2 1 0 0 0 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 0 4 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 1 3 4 1 0 0 0 2 0 0 3 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 2 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 13 26 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 22 20 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 18 29 12
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 44 (8.54%)
Serine (Ser, S)
n = 32 (6.21%)
Threonine (Thr, T)
n = 37 (7.18%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.57%)
Leucine (Leu, L)
n = 55 (10.68%)
Isoleucine (Ile, I)
n = 39 (7.57%)
Methionine (Met, M)
n = 32 (6.21%)
Proline (Pro, P)
n = 26 (5.05%)
Phenylalanine (Phe, F)
n = 41 (7.96%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.72%)
Glutamine (Gln, Q)
n = 9 (1.75%)
Histidine (His, H)
n = 21 (4.08%)
Lysine (Lys, K)
n = 10 (1.94%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 17 30 8 3 23 2 18 8 1 7 6 23 3 18 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 11 14 19 0 6 13 23 5 6 4 15 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 13 1 7 7 14 0 2 2 10 8 2 1 7 7 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 4 11 10 0 2 2 4 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
155 100 137 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 135 97 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 144 224 128
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 11 (4.82%)
Serine (Ser, S)
n = 14 (6.14%)
Threonine (Thr, T)
n = 19 (8.33%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 15 (6.58%)
Leucine (Leu, L)
n = 27 (11.84%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 18 (7.89%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 6 (2.63%)
Aspartic acid (Asp, D)
n = 8 (3.51%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 9 (3.95%)
Glutamine (Gln, Q)
n = 6 (2.63%)
Histidine (His, H)
n = 11 (4.82%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 14 1 4 12 2 7 6 0 1 4 10 0 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 2 3 6 0 0 1 6 1 1 4 8 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 0 2 4 5 1 0 2 3 6 0 1 3 6 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 0 2 6 3 0 1 0 4 1 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 56 69 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 56 61 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 63 109 46
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 19 (7.31%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 5 11 2 4 18 1 7 7 1 0 2 12 1 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 3 9 7 0 4 6 8 1 1 3 8 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 3 0 7 1 1 3 5 6 0 1 2 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 1 3 1 2 0 1 0 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 66 63 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 53 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 76 119 56
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 19 (5.01%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 36 (9.5%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 14 (3.69%)
Leucine (Leu, L)
n = 63 (16.62%)
Isoleucine (Ile, I)
n = 34 (8.97%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 22 (5.8%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 19 11 10 11 31 0 11 9 0 2 2 10 0 8 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 3 11 5 0 8 6 10 2 1 5 16 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 13 1 4 8 12 0 0 1 4 9 2 0 1 21 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 2 6 9 0 1 0 7 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 104 115 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 102 79 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 144 159 69
ND1 (size: 971 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 21 (6.52%)
Serine (Ser, S)
n = 29 (9.01%)
Threonine (Thr, T)
n = 18 (5.59%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 10 (3.11%)
Leucine (Leu, L)
n = 64 (19.88%)
Isoleucine (Ile, I)
n = 20 (6.21%)
Methionine (Met, M)
n = 25 (7.76%)
Proline (Pro, P)
n = 25 (7.76%)
Phenylalanine (Phe, F)
n = 20 (6.21%)
Tyrosine (Tyr, Y)
n = 12 (3.73%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 15 (4.66%)
Glutamine (Gln, Q)
n = 6 (1.86%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 9 (2.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 12 25 8 4 34 1 16 5 1 2 1 7 0 6 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 0 4 9 8 0 4 2 10 0 1 6 17 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 7 0 4 11 13 0 0 1 3 9 0 1 6 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 0 2 2 7 0 1 1 6 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 89 86 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 92 57 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 90 174 54
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 21 (6.09%)
Serine (Ser, S)
n = 27 (7.83%)
Threonine (Thr, T)
n = 58 (16.81%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 62 (17.97%)
Isoleucine (Ile, I)
n = 31 (8.99%)
Methionine (Met, M)
n = 25 (7.25%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 10 (2.9%)
Tyrosine (Tyr, Y)
n = 10 (2.9%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 20 24 5 4 43 1 9 12 1 0 0 4 0 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 12 5 0 2 2 7 1 2 2 15 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 28 0 5 5 11 0 3 3 2 8 0 0 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 1 0 13 0 0 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 96 145 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 119 61 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 99 189 53
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 21 (6.09%)
Serine (Ser, S)
n = 27 (7.83%)
Threonine (Thr, T)
n = 58 (16.81%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 62 (17.97%)
Isoleucine (Ile, I)
n = 31 (8.99%)
Methionine (Met, M)
n = 25 (7.25%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 10 (2.9%)
Tyrosine (Tyr, Y)
n = 10 (2.9%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 20 24 5 4 43 1 9 12 1 0 0 4 0 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 12 5 0 2 2 7 1 2 2 15 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 28 0 5 5 11 0 3 3 2 8 0 0 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 1 0 13 0 0 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 96 145 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 119 61 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 99 189 53
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.58%)
Alanine (Ala, A)
n = 31 (6.75%)
Serine (Ser, S)
n = 31 (6.75%)
Threonine (Thr, T)
n = 57 (12.42%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 8 (1.74%)
Leucine (Leu, L)
n = 85 (18.52%)
Isoleucine (Ile, I)
n = 45 (9.8%)
Methionine (Met, M)
n = 29 (6.32%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 18 (3.92%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 15 (3.27%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.7%)
Glutamine (Gln, Q)
n = 15 (3.27%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 12 (2.61%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 23 28 10 14 47 1 11 15 0 1 0 6 1 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 6 11 14 0 3 4 10 4 1 6 15 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 31 0 1 8 15 0 3 4 6 10 2 2 5 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 9 1 1 1 11 1 1 1 7 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 131 167 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 136 82 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 132 232 80
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 5 (5.1%)
Serine (Ser, S)
n = 16 (16.33%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 5 (5.1%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 6 3 3 5 1 8 4 1 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 0 2 3 0 0 3 1 0 0 1 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 0 2 10 1 3 0 2 1 0 0 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 0 0 0 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
13 25 28 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 28 19 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 28 45 20
ND5 (size: 1809 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.98%)
Alanine (Ala, A)
n = 47 (7.81%)
Serine (Ser, S)
n = 41 (6.81%)
Threonine (Thr, T)
n = 55 (9.14%)
Cysteine (Cys, C)
n = 6 (1.0%)
Valine (Val, V)
n = 22 (3.65%)
Leucine (Leu, L)
n = 91 (15.12%)
Isoleucine (Ile, I)
n = 57 (9.47%)
Methionine (Met, M)
n = 40 (6.64%)
Proline (Pro, P)
n = 29 (4.82%)
Phenylalanine (Phe, F)
n = 40 (6.64%)
Tyrosine (Tyr, Y)
n = 19 (3.16%)
Tryptophan (Trp, W)
n = 14 (2.33%)
Aspartic acid (Asp, D)
n = 8 (1.33%)
Glutamic acid (Glu, E)
n = 13 (2.16%)
Asparagine (Asn, N)
n = 24 (3.99%)
Glutamine (Gln, Q)
n = 11 (1.83%)
Histidine (His, H)
n = 16 (2.66%)
Lysine (Lys, K)
n = 28 (4.65%)
Arginine (Arg, R)
n = 11 (1.83%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 26 39 8 12 38 6 26 10 1 2 7 13 0 14 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 5 14 14 17 2 4 15 11 0 3 8 18 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 28 1 5 9 17 1 0 9 6 13 1 1 7 17 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 2 2 6 28 0 0 6 5 0 0 0 0 1 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
120 131 213 139
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 163 120 250
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 199 274 113
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (17.82%)
Alanine (Ala, A)
n = 6 (3.45%)
Serine (Ser, S)
n = 14 (8.05%)
Threonine (Thr, T)
n = 3 (1.72%)
Cysteine (Cys, C)
n = 6 (3.45%)
Valine (Val, V)
n = 29 (16.67%)
Leucine (Leu, L)
n = 28 (16.09%)
Isoleucine (Ile, I)
n = 3 (1.72%)
Methionine (Met, M)
n = 10 (5.75%)
Proline (Pro, P)
n = 4 (2.3%)
Phenylalanine (Phe, F)
n = 16 (9.2%)
Tyrosine (Tyr, Y)
n = 10 (5.75%)
Tryptophan (Trp, W)
n = 4 (2.3%)
Aspartic acid (Asp, D)
n = 3 (1.72%)
Glutamic acid (Glu, E)
n = 3 (1.72%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.57%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 3 3 0 1 2 11 0 0 11 2 8 8 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 5 1 3 0 1 2 13 0 5 13 1 1 1 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 9 0 2 1 2 0 9 1 2 11 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 3 0 0 0 1 0 0 1 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 13 20 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 25 18 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 5 36 81
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 227 (5.98%)
Alanine (Ala, A)
n = 244 (6.42%)
Serine (Ser, S)
n = 272 (7.16%)
Threonine (Thr, T)
n = 366 (9.64%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 167 (4.4%)
Leucine (Leu, L)
n = 612 (16.11%)
Isoleucine (Ile, I)
n = 301 (7.93%)
Methionine (Met, M)
n = 237 (6.24%)
Proline (Pro, P)
n = 209 (5.5%)
Phenylalanine (Phe, F)
n = 226 (5.95%)
Tyrosine (Tyr, Y)
n = 127 (3.34%)
Tryptophan (Trp, W)
n = 113 (2.98%)
Aspartic acid (Asp, D)
n = 60 (1.58%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 140 (3.69%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 107 (2.82%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
151 150 211 70 72 274 24 150 91 7 27 24 100 16 94 132
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
26 13 17 54 94 92 4 47 55 97 28 19 42 139 9 74
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
125 162 5 44 62 116 7 14 29 50 77 12 22 43 97 40
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
67 81 11 23 37 91 1 8 13 45 5 0 2 5 1 101
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
790 925 1181 903
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
486 1048 722 1543
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
180 1093 1755 771

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.