Viewing data for Crocodylus moreletii


Scientific name Crocodylus moreletii
Common name Morelet's crocodile
Maximum lifespan 25.40 years (Crocodylus moreletii@AnAge)

Total mtDNA (size: 16827 bases) GC AT G C A T
Base content (bases) 7231 9588 4749 2482 4207 5381
Base content per 1 kb (bases) 430 570 282 148 250 320
Base content (%) 43.0% 57.0%
Total protein-coding genes (size: 11382 bases) GC AT G C A T
Base content (bases) 4971 6405 3431 1540 2911 3494
Base content per 1 kb (bases) 437 563 301 135 256 307
Base content (%) 43.7% 56.3%
D-loop (size: 1076 bases) GC AT G C A T
Base content (bases) 341 735 209 132 334 401
Base content per 1 kb (bases) 317 683 194 123 310 373
Base content (%) 31.7% 68.3%
Total tRNA-coding genes (size: 1546 bases) GC AT G C A T
Base content (bases) 665 880 384 281 392 488
Base content per 1 kb (bases) 430 569 248 182 254 316
Base content (%) 43.0% 56.9%
Total rRNA-coding genes (size: 2582 bases) GC AT G C A T
Base content (bases) 1151 1430 644 507 531 899
Base content per 1 kb (bases) 446 554 249 196 206 348
Base content (%) 44.6% 55.4%
12S rRNA gene (size: 987 bases) GC AT G C A T
Base content (bases) 470 516 258 212 196 320
Base content per 1 kb (bases) 476 523 261 215 199 324
Base content (%) 47.6% 52.3%
16S rRNA gene (size: 1595 bases) GC AT G C A T
Base content (bases) 681 914 386 295 335 579
Base content per 1 kb (bases) 427 573 242 185 210 363
Base content (%) 42.7% 57.3%

ATP6 (size: 696 bases) GC AT G C A T
Base content (bases) 305 391 218 87 173 218
Base content per 1 kb (bases) 438 562 313 125 249 313
Base content (%) 43.8% 56.2%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 55 107 41 14 41 66
Base content per 1 kb (bases) 340 660 253 86 253 407
Base content (%) 34.0% 66.0%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 656 896 409 247 440 456
Base content per 1 kb (bases) 421 575 263 159 283 293
Base content (%) 42.1% 57.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 285 399 191 94 168 231
Base content per 1 kb (bases) 417 583 279 137 246 338
Base content (%) 41.7% 58.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 359 425 237 122 206 219
Base content per 1 kb (bases) 458 542 302 156 263 279
Base content (%) 45.8% 54.2%
CYTB (size: 1156 bases) GC AT G C A T
Base content (bases) 513 643 358 155 299 344
Base content per 1 kb (bases) 444 556 310 134 259 298
Base content (%) 44.4% 55.6%
ND1 (size: 963 bases) GC AT G C A T
Base content (bases) 431 532 284 147 261 271
Base content per 1 kb (bases) 448 552 295 153 271 281
Base content (%) 44.8% 55.2%
ND2 (size: 1056 bases) GC AT G C A T
Base content (bases) 462 594 337 125 270 324
Base content per 1 kb (bases) 438 563 319 118 256 307
Base content (%) 43.8% 56.3%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 159 189 103 56 88 101
Base content per 1 kb (bases) 457 543 296 161 253 290
Base content (%) 45.7% 54.3%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 605 768 423 182 350 418
Base content per 1 kb (bases) 440 559 308 132 255 304
Base content (%) 44.0% 55.9%
ND4L (size: 294 bases) GC AT G C A T
Base content (bases) 132 162 96 36 86 76
Base content per 1 kb (bases) 449 551 327 122 293 259
Base content (%) 44.9% 55.1%
ND5 (size: 1860 bases) GC AT G C A T
Base content (bases) 806 1054 579 227 459 595
Base content per 1 kb (bases) 433 567 311 122 247 320
Base content (%) 43.3% 56.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 240 288 180 60 84 204
Base content per 1 kb (bases) 455 545 341 114 159 386
Base content (%) 45.5% 54.5%

ATP6 (size: 696 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.03%)
Alanine (Ala, A)
n = 19 (8.23%)
Serine (Ser, S)
n = 11 (4.76%)
Threonine (Thr, T)
n = 26 (11.26%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.03%)
Leucine (Leu, L)
n = 63 (27.27%)
Isoleucine (Ile, I)
n = 19 (8.23%)
Methionine (Met, M)
n = 12 (5.19%)
Proline (Pro, P)
n = 15 (6.49%)
Phenylalanine (Phe, F)
n = 5 (2.16%)
Tyrosine (Tyr, Y)
n = 4 (1.73%)
Tryptophan (Trp, W)
n = 4 (1.73%)
Aspartic acid (Asp, D)
n = 2 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.73%)
Asparagine (Asn, N)
n = 12 (5.19%)
Glutamine (Gln, Q)
n = 7 (3.03%)
Histidine (His, H)
n = 4 (1.73%)
Lysine (Lys, K)
n = 6 (2.6%)
Arginine (Arg, R)
n = 4 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 15 8 6 12 19 12 10 7 0 0 0 5 2 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 1 8 9 1 0 3 3 1 2 1 9 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 1 4 1 4 1 0 1 3 1 0 4 1 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 2 4 2 0 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 79 76 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 70 40 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 69 102 29
ATP8 (size: 162 bases)
Amino acid sequence: MPQLNPEPWLMISSITWLVFIITLQPKIASMKFMNNPSNPNQKTTKTWPWPQI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.89%)
Serine (Ser, S)
n = 4 (7.55%)
Threonine (Thr, T)
n = 5 (9.43%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.89%)
Leucine (Leu, L)
n = 4 (7.55%)
Isoleucine (Ile, I)
n = 6 (11.32%)
Methionine (Met, M)
n = 4 (7.55%)
Proline (Pro, P)
n = 8 (15.09%)
Phenylalanine (Phe, F)
n = 2 (3.77%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 4 (7.55%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.89%)
Asparagine (Asn, N)
n = 5 (9.43%)
Glutamine (Gln, Q)
n = 4 (7.55%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.55%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 1 0 0 1 0 3 3 1 0 0 1 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 0 0 0 0 0 0 0 1 1 5 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 2 0 1 0 0 1 0 0 1 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 4 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 13 25 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 17 15 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 11 26 11
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.3%)
Alanine (Ala, A)
n = 36 (6.95%)
Serine (Ser, S)
n = 34 (6.56%)
Threonine (Thr, T)
n = 38 (7.34%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.34%)
Leucine (Leu, L)
n = 54 (10.42%)
Isoleucine (Ile, I)
n = 40 (7.72%)
Methionine (Met, M)
n = 31 (5.98%)
Proline (Pro, P)
n = 31 (5.98%)
Phenylalanine (Phe, F)
n = 46 (8.88%)
Tyrosine (Tyr, Y)
n = 17 (3.28%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 14 (2.7%)
Glutamic acid (Glu, E)
n = 8 (1.54%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 12 (2.32%)
Histidine (His, H)
n = 16 (3.09%)
Lysine (Lys, K)
n = 11 (2.12%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 18 24 9 12 20 2 8 10 2 11 4 21 2 20 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 7 16 13 0 4 9 22 8 2 8 19 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 0 2 8 15 1 0 8 8 9 2 3 7 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 1 6 8 10 1 1 1 6 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
139 110 146 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 131 97 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 164 209 110
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 10 (4.41%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 10 (4.41%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 8 10 1 5 17 1 6 7 3 1 4 6 1 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 2 2 5 1 1 1 5 1 2 4 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 1 4 2 6 0 1 3 6 3 1 1 1 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 3 1 9 3 0 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 63 68 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 57 63 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 71 100 39
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 8 12 2 6 17 3 6 5 1 4 7 4 0 5 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 3 13 3 1 3 7 4 4 2 1 10 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 0 0 1 8 0 0 7 7 4 2 0 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 1 1 3 1 0 0 0 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 69 65 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 52 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 103 102 43
CYTB (size: 1156 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.25%)
Alanine (Ala, A)
n = 30 (7.81%)
Serine (Ser, S)
n = 26 (6.77%)
Threonine (Thr, T)
n = 24 (6.25%)
Cysteine (Cys, C)
n = 1 (0.26%)
Valine (Val, V)
n = 15 (3.91%)
Leucine (Leu, L)
n = 67 (17.45%)
Isoleucine (Ile, I)
n = 30 (7.81%)
Methionine (Met, M)
n = 17 (4.43%)
Proline (Pro, P)
n = 24 (6.25%)
Phenylalanine (Phe, F)
n = 28 (7.29%)
Tyrosine (Tyr, Y)
n = 15 (3.91%)
Tryptophan (Trp, W)
n = 12 (3.13%)
Aspartic acid (Asp, D)
n = 11 (2.86%)
Glutamic acid (Glu, E)
n = 6 (1.56%)
Asparagine (Asn, N)
n = 15 (3.91%)
Glutamine (Gln, Q)
n = 8 (2.08%)
Histidine (His, H)
n = 12 (3.13%)
Lysine (Lys, K)
n = 9 (2.34%)
Arginine (Arg, R)
n = 11 (2.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 19 14 10 8 31 4 13 8 0 2 5 8 0 6 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 15 11 0 1 3 16 4 2 5 15 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 1 4 8 11 0 0 3 2 13 1 1 1 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 1 10 8 1 0 3 7 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 108 98 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 101 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 149 170 48
ND1 (size: 963 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 29 (9.06%)
Serine (Ser, S)
n = 25 (7.81%)
Threonine (Thr, T)
n = 26 (8.13%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 19 (5.94%)
Leucine (Leu, L)
n = 64 (20.0%)
Isoleucine (Ile, I)
n = 25 (7.81%)
Methionine (Met, M)
n = 12 (3.75%)
Proline (Pro, P)
n = 18 (5.63%)
Phenylalanine (Phe, F)
n = 19 (5.94%)
Tyrosine (Tyr, Y)
n = 11 (3.44%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 10 (3.13%)
Asparagine (Asn, N)
n = 11 (3.44%)
Glutamine (Gln, Q)
n = 6 (1.88%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 15 12 5 4 27 12 14 4 2 4 9 4 2 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 1 4 12 13 0 2 8 4 2 2 6 8 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 3 5 5 8 2 2 3 3 8 0 2 1 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 3 1 2 7 0 1 1 4 1 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 82 87 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 93 51 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 109 133 47
ND2 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.13%)
Alanine (Ala, A)
n = 32 (9.12%)
Serine (Ser, S)
n = 30 (8.55%)
Threonine (Thr, T)
n = 44 (12.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (3.99%)
Leucine (Leu, L)
n = 65 (18.52%)
Isoleucine (Ile, I)
n = 34 (9.69%)
Methionine (Met, M)
n = 13 (3.7%)
Proline (Pro, P)
n = 18 (5.13%)
Phenylalanine (Phe, F)
n = 16 (4.56%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 8 (2.28%)
Asparagine (Asn, N)
n = 11 (3.13%)
Glutamine (Gln, Q)
n = 16 (4.56%)
Histidine (His, H)
n = 2 (0.57%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 15 10 11 10 30 3 9 13 3 2 3 5 4 2 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 19 8 1 0 5 4 2 0 6 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 21 3 6 13 5 2 0 4 4 5 3 2 3 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 3 0 1 12 0 0 1 4 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 95 118 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 120 60 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 122 146 55
ND3 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.13%)
Alanine (Ala, A)
n = 32 (9.12%)
Serine (Ser, S)
n = 30 (8.55%)
Threonine (Thr, T)
n = 44 (12.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (3.99%)
Leucine (Leu, L)
n = 65 (18.52%)
Isoleucine (Ile, I)
n = 34 (9.69%)
Methionine (Met, M)
n = 13 (3.7%)
Proline (Pro, P)
n = 18 (5.13%)
Phenylalanine (Phe, F)
n = 16 (4.56%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 8 (2.28%)
Asparagine (Asn, N)
n = 11 (3.13%)
Glutamine (Gln, Q)
n = 16 (4.56%)
Histidine (His, H)
n = 2 (0.57%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 15 10 11 10 30 3 9 13 3 2 3 5 4 2 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 19 8 1 0 5 4 2 0 6 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 21 3 6 13 5 2 0 4 4 5 3 2 3 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 3 0 1 12 0 0 1 4 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 95 118 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 120 60 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 122 146 55
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (4.81%)
Alanine (Ala, A)
n = 32 (7.0%)
Serine (Ser, S)
n = 42 (9.19%)
Threonine (Thr, T)
n = 52 (11.38%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 17 (3.72%)
Leucine (Leu, L)
n = 89 (19.47%)
Isoleucine (Ile, I)
n = 36 (7.88%)
Methionine (Met, M)
n = 31 (6.78%)
Proline (Pro, P)
n = 23 (5.03%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 11 (2.41%)
Aspartic acid (Asp, D)
n = 7 (1.53%)
Glutamic acid (Glu, E)
n = 7 (1.53%)
Asparagine (Asn, N)
n = 9 (1.97%)
Glutamine (Gln, Q)
n = 18 (3.94%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 8 (1.75%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 17 23 11 13 43 4 14 15 3 3 5 8 1 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 5 1 19 9 3 4 7 9 2 3 8 11 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 20 7 3 12 14 2 1 10 4 9 2 4 3 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 1 0 7 8 0 0 1 7 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 131 147 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
58 138 73 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 154 197 67
ND4L (size: 294 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.12%)
Alanine (Ala, A)
n = 8 (8.25%)
Serine (Ser, S)
n = 10 (10.31%)
Threonine (Thr, T)
n = 11 (11.34%)
Cysteine (Cys, C)
n = 3 (3.09%)
Valine (Val, V)
n = 2 (2.06%)
Leucine (Leu, L)
n = 23 (23.71%)
Isoleucine (Ile, I)
n = 7 (7.22%)
Methionine (Met, M)
n = 3 (3.09%)
Proline (Pro, P)
n = 2 (2.06%)
Phenylalanine (Phe, F)
n = 7 (7.22%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.03%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.06%)
Asparagine (Asn, N)
n = 7 (7.22%)
Glutamine (Gln, Q)
n = 1 (1.03%)
Histidine (His, H)
n = 3 (3.09%)
Lysine (Lys, K)
n = 1 (1.03%)
Arginine (Arg, R)
n = 2 (2.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 1 2 4 8 4 5 1 0 0 1 1 0 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 1 5 2 0 0 3 0 1 1 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 0 1 3 5 1 0 0 0 0 1 0 1 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 0 1 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 26 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 31 15 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 39 32 17
ND5 (size: 1860 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.04%)
Alanine (Ala, A)
n = 51 (8.24%)
Serine (Ser, S)
n = 60 (9.69%)
Threonine (Thr, T)
n = 66 (10.66%)
Cysteine (Cys, C)
n = 4 (0.65%)
Valine (Val, V)
n = 21 (3.39%)
Leucine (Leu, L)
n = 100 (16.16%)
Isoleucine (Ile, I)
n = 59 (9.53%)
Methionine (Met, M)
n = 36 (5.82%)
Proline (Pro, P)
n = 28 (4.52%)
Phenylalanine (Phe, F)
n = 29 (4.68%)
Tyrosine (Tyr, Y)
n = 17 (2.75%)
Tryptophan (Trp, W)
n = 7 (1.13%)
Aspartic acid (Asp, D)
n = 14 (2.26%)
Glutamic acid (Glu, E)
n = 14 (2.26%)
Asparagine (Asn, N)
n = 24 (3.88%)
Glutamine (Gln, Q)
n = 20 (3.23%)
Histidine (His, H)
n = 12 (1.94%)
Lysine (Lys, K)
n = 23 (3.72%)
Arginine (Arg, R)
n = 9 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 30 29 11 16 41 15 15 18 2 2 6 12 1 10 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 3 5 27 19 0 2 9 11 3 4 8 15 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 21 3 4 17 24 1 1 13 5 12 1 2 4 20 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 12 2 1 13 19 4 0 3 5 1 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
125 152 222 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 191 125 245
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 236 248 93
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.0%)
Alanine (Ala, A)
n = 11 (6.29%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 5 (2.86%)
Cysteine (Cys, C)
n = 7 (4.0%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 26 (14.86%)
Isoleucine (Ile, I)
n = 8 (4.57%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 1 (0.57%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 7 (4.0%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 5 (2.86%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.14%)
Lysine (Lys, K)
n = 2 (1.14%)
Arginine (Arg, R)
n = 4 (2.29%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 2 2 4 1 4 2 8 0 0 9 1 3 12 11 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 6 1 5 1 4 1 5 6 5 12 0 0 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 3 0 1 1 5 2 6 1 4 7 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 5 4 0 1 1 2 0 1 1 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 18 32 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 22 21 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 20 31 70
Total protein-coding genes (size: 11462 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 211 (5.53%)
Alanine (Ala, A)
n = 292 (7.65%)
Serine (Ser, S)
n = 292 (7.65%)
Threonine (Thr, T)
n = 349 (9.14%)
Cysteine (Cys, C)
n = 28 (0.73%)
Valine (Val, V)
n = 189 (4.95%)
Leucine (Leu, L)
n = 645 (16.89%)
Isoleucine (Ile, I)
n = 307 (8.04%)
Methionine (Met, M)
n = 200 (5.24%)
Proline (Pro, P)
n = 201 (5.26%)
Phenylalanine (Phe, F)
n = 220 (5.76%)
Tyrosine (Tyr, Y)
n = 115 (3.01%)
Tryptophan (Trp, W)
n = 100 (2.62%)
Aspartic acid (Asp, D)
n = 73 (1.91%)
Glutamic acid (Glu, E)
n = 91 (2.38%)
Asparagine (Asn, N)
n = 129 (3.38%)
Glutamine (Gln, Q)
n = 110 (2.88%)
Histidine (His, H)
n = 91 (2.38%)
Lysine (Lys, K)
n = 89 (2.33%)
Arginine (Arg, R)
n = 71 (1.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
145 162 150 75 93 271 66 114 93 17 38 46 80 25 81 139
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
50 12 16 39 144 101 8 23 62 86 40 21 50 116 14 48
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
129 152 20 39 71 104 11 10 57 49 66 19 26 26 103 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
74 67 24 15 58 80 9 4 17 45 5 0 2 8 1 81
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
856 978 1143 837
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
479 1067 707 1561
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
337 1287 1548 642

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.