Viewing data for Calotes versicolor


Scientific name Calotes versicolor
Common name Indian changeable lizard
Maximum lifespan 5.00 years (Calotes versicolor@AnAge)

Total mtDNA (size: 16670 bases) GC AT G C A T
Base content (bases) 6711 9959 4497 2214 4331 5628
Base content per 1 kb (bases) 403 597 270 133 260 338
Base content (%) 40.3% 59.7%
Total protein-coding genes (size: 11241 bases) GC AT G C A T
Base content (bases) 4623 6618 3230 1393 2969 3649
Base content per 1 kb (bases) 411 589 287 124 264 325
Base content (%) 41.1% 58.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1469 bases) GC AT G C A T
Base content (bases) 616 853 364 252 360 493
Base content per 1 kb (bases) 419 581 248 172 245 336
Base content (%) 41.9% 58.1%
Total rRNA-coding genes (size: 2380 bases) GC AT G C A T
Base content (bases) 1036 1344 613 423 468 876
Base content per 1 kb (bases) 435 565 258 178 197 368
Base content (%) 43.5% 56.5%
12S rRNA gene (size: 832 bases) GC AT G C A T
Base content (bases) 359 473 203 156 172 301
Base content per 1 kb (bases) 431 569 244 188 207 362
Base content (%) 43.1% 56.9%
16S rRNA gene (size: 1548 bases) GC AT G C A T
Base content (bases) 677 871 410 267 296 575
Base content per 1 kb (bases) 437 563 265 172 191 371
Base content (%) 43.7% 56.3%

ATP6 (size: 682 bases) GC AT G C A T
Base content (bases) 280 402 208 72 179 223
Base content per 1 kb (bases) 411 589 305 106 262 327
Base content (%) 41.1% 58.9%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 64 98 48 16 40 58
Base content per 1 kb (bases) 395 605 296 99 247 358
Base content (%) 39.5% 60.5%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 651 891 398 253 454 437
Base content per 1 kb (bases) 422 578 258 164 294 283
Base content (%) 42.2% 57.8%
COX2 (size: 681 bases) GC AT G C A T
Base content (bases) 287 394 194 93 173 221
Base content per 1 kb (bases) 421 579 285 137 254 325
Base content (%) 42.1% 57.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 342 442 227 115 221 221
Base content per 1 kb (bases) 436 564 290 147 282 282
Base content (%) 43.6% 56.4%
CYTB (size: 1125 bases) GC AT G C A T
Base content (bases) 469 656 334 135 310 346
Base content per 1 kb (bases) 417 583 297 120 276 308
Base content (%) 41.7% 58.3%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 385 581 260 125 262 319
Base content per 1 kb (bases) 399 601 269 129 271 330
Base content (%) 39.9% 60.1%
ND2 (size: 1023 bases) GC AT G C A T
Base content (bases) 417 606 305 112 248 358
Base content per 1 kb (bases) 408 592 298 109 242 350
Base content (%) 40.8% 59.2%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 154 195 103 51 99 96
Base content per 1 kb (bases) 441 559 295 146 284 275
Base content (%) 44.1% 55.9%
ND4 (size: 1365 bases) GC AT G C A T
Base content (bases) 546 819 391 155 380 439
Base content per 1 kb (bases) 400 600 286 114 278 322
Base content (%) 40.0% 60.0%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 104 187 78 26 85 102
Base content per 1 kb (bases) 357 643 268 89 292 351
Base content (%) 35.7% 64.3%
ND5 (size: 1785 bases) GC AT G C A T
Base content (bases) 714 1071 531 183 455 616
Base content per 1 kb (bases) 400 600 297 103 255 345
Base content (%) 40.0% 60.0%
ND6 (size: 507 bases) GC AT G C A T
Base content (bases) 215 292 156 59 69 223
Base content per 1 kb (bases) 424 576 308 116 136 440
Base content (%) 42.4% 57.6%

ATP6 (size: 682 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (2.21%)
Alanine (Ala, A)
n = 21 (9.29%)
Serine (Ser, S)
n = 9 (3.98%)
Threonine (Thr, T)
n = 34 (15.04%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 49 (21.68%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 8 (3.54%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 6 (2.65%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 6 (2.65%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 6 10 7 5 24 3 8 6 0 2 5 2 1 6 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 8 11 0 1 1 3 0 1 2 10 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 13 1 0 3 2 0 0 4 0 3 1 2 6 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 1 1 4 2 0 3 2 0 0 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 70 86 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 74 36 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 64 101 49
ATP8 (size: 162 bases)
Amino acid sequence: VPQLNPSPWFLTMLITWLFLLIMMTKTTAWTTTTNPTTQNFNFTKSPWTWSWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.89%)
Serine (Ser, S)
n = 3 (5.66%)
Threonine (Thr, T)
n = 13 (24.53%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.89%)
Leucine (Leu, L)
n = 6 (11.32%)
Isoleucine (Ile, I)
n = 2 (3.77%)
Methionine (Met, M)
n = 3 (5.66%)
Proline (Pro, P)
n = 5 (9.43%)
Phenylalanine (Phe, F)
n = 4 (7.55%)
Tyrosine (Tyr, Y)
n = 1 (1.89%)
Tryptophan (Trp, W)
n = 6 (11.32%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.55%)
Glutamine (Gln, Q)
n = 2 (3.77%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.77%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 1 1 1 2 0 1 2 0 0 0 0 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 0 0 0 0 0 0 0 2 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 0 0 1 1 0 1 0 0 1 2 1 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 1 1 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 11 25 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 21 10 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 16 23 8
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.38%)
Alanine (Ala, A)
n = 37 (7.21%)
Serine (Ser, S)
n = 38 (7.41%)
Threonine (Thr, T)
n = 42 (8.19%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 28 (5.46%)
Leucine (Leu, L)
n = 61 (11.89%)
Isoleucine (Ile, I)
n = 38 (7.41%)
Methionine (Met, M)
n = 34 (6.63%)
Proline (Pro, P)
n = 30 (5.85%)
Phenylalanine (Phe, F)
n = 43 (8.38%)
Tyrosine (Tyr, Y)
n = 17 (3.31%)
Tryptophan (Trp, W)
n = 18 (3.51%)
Aspartic acid (Asp, D)
n = 12 (2.34%)
Glutamic acid (Glu, E)
n = 8 (1.56%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 8 (1.56%)
Histidine (His, H)
n = 19 (3.7%)
Lysine (Lys, K)
n = 10 (1.95%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 24 17 6 16 5 15 7 1 10 4 13 1 22 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 8 11 16 2 2 11 18 12 4 9 15 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 3 2 8 19 2 1 6 8 9 3 2 5 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 5 3 4 8 9 1 1 3 5 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
128 110 148 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 140 92 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 148 197 122
COX2 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.54%)
Alanine (Ala, A)
n = 8 (3.54%)
Serine (Ser, S)
n = 17 (7.52%)
Threonine (Thr, T)
n = 29 (12.83%)
Cysteine (Cys, C)
n = 3 (1.33%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 30 (13.27%)
Isoleucine (Ile, I)
n = 13 (5.75%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 8 (3.54%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 10 (4.42%)
Glutamic acid (Glu, E)
n = 13 (5.75%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 6 (2.65%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 6 (2.65%)
Arginine (Arg, R)
n = 7 (3.1%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 6 9 7 2 12 2 6 5 1 1 4 5 2 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 1 5 2 0 2 1 3 2 4 4 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 0 2 6 5 2 1 1 0 8 0 1 3 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 3 2 8 6 0 2 2 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 56 71 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 66 58 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 72 92 46
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 26 (10.0%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 7 (2.69%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 6 12 4 8 16 1 5 5 1 4 4 7 1 13 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 3 9 3 0 0 9 8 2 0 3 7 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 1 3 5 6 1 1 2 4 5 1 1 0 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 5 2 0 3 5 2 1 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 67 65 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 63 54 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 97 102 47
CYTB (size: 1125 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.15%)
Alanine (Ala, A)
n = 22 (5.88%)
Serine (Ser, S)
n = 28 (7.49%)
Threonine (Thr, T)
n = 38 (10.16%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (3.74%)
Leucine (Leu, L)
n = 56 (14.97%)
Isoleucine (Ile, I)
n = 38 (10.16%)
Methionine (Met, M)
n = 16 (4.28%)
Proline (Pro, P)
n = 22 (5.88%)
Phenylalanine (Phe, F)
n = 23 (6.15%)
Tyrosine (Tyr, Y)
n = 16 (4.28%)
Tryptophan (Trp, W)
n = 11 (2.94%)
Aspartic acid (Asp, D)
n = 4 (1.07%)
Glutamic acid (Glu, E)
n = 8 (2.14%)
Asparagine (Asn, N)
n = 20 (5.35%)
Glutamine (Gln, Q)
n = 7 (1.87%)
Histidine (His, H)
n = 13 (3.48%)
Lysine (Lys, K)
n = 9 (2.41%)
Arginine (Arg, R)
n = 6 (1.6%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 12 11 9 17 5 14 7 0 3 4 6 1 10 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 12 5 2 2 10 7 4 1 9 11 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 2 4 6 15 0 1 2 5 11 1 0 1 19 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 1 0 4 9 0 0 1 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 90 124 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 107 78 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 137 144 73
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.36%)
Alanine (Ala, A)
n = 26 (8.1%)
Serine (Ser, S)
n = 22 (6.85%)
Threonine (Thr, T)
n = 34 (10.59%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 15 (4.67%)
Leucine (Leu, L)
n = 52 (16.2%)
Isoleucine (Ile, I)
n = 18 (5.61%)
Methionine (Met, M)
n = 24 (7.48%)
Proline (Pro, P)
n = 19 (5.92%)
Phenylalanine (Phe, F)
n = 22 (6.85%)
Tyrosine (Tyr, Y)
n = 10 (3.12%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 5 (1.56%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 14 (4.36%)
Glutamine (Gln, Q)
n = 10 (3.12%)
Histidine (His, H)
n = 1 (0.31%)
Lysine (Lys, K)
n = 8 (2.49%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 18 7 5 23 1 15 10 0 3 3 8 1 13 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 4 11 9 2 1 2 5 6 0 4 14 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 1 1 7 12 0 0 2 2 8 0 1 5 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 8 2 1 4 8 0 0 2 5 0 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 73 101 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 99 58 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 88 160 53
ND2 (size: 1023 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.82%)
Alanine (Ala, A)
n = 28 (8.24%)
Serine (Ser, S)
n = 29 (8.53%)
Threonine (Thr, T)
n = 60 (17.65%)
Cysteine (Cys, C)
n = 2 (0.59%)
Valine (Val, V)
n = 4 (1.18%)
Leucine (Leu, L)
n = 60 (17.65%)
Isoleucine (Ile, I)
n = 22 (6.47%)
Methionine (Met, M)
n = 26 (7.65%)
Proline (Pro, P)
n = 18 (5.29%)
Phenylalanine (Phe, F)
n = 12 (3.53%)
Tyrosine (Tyr, Y)
n = 5 (1.47%)
Tryptophan (Trp, W)
n = 10 (2.94%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.47%)
Asparagine (Asn, N)
n = 14 (4.12%)
Glutamine (Gln, Q)
n = 10 (2.94%)
Histidine (His, H)
n = 3 (0.88%)
Lysine (Lys, K)
n = 14 (4.12%)
Arginine (Arg, R)
n = 4 (1.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 11 22 14 5 20 6 15 10 0 0 1 2 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 5 11 11 1 2 6 3 2 1 4 13 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 23 4 1 3 19 0 1 5 0 5 2 0 7 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 2 0 1 12 2 0 1 1 2 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 80 142 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 129 53 124
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 96 163 56
ND3 (size: 1023 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.82%)
Alanine (Ala, A)
n = 28 (8.24%)
Serine (Ser, S)
n = 29 (8.53%)
Threonine (Thr, T)
n = 60 (17.65%)
Cysteine (Cys, C)
n = 2 (0.59%)
Valine (Val, V)
n = 4 (1.18%)
Leucine (Leu, L)
n = 60 (17.65%)
Isoleucine (Ile, I)
n = 22 (6.47%)
Methionine (Met, M)
n = 26 (7.65%)
Proline (Pro, P)
n = 18 (5.29%)
Phenylalanine (Phe, F)
n = 12 (3.53%)
Tyrosine (Tyr, Y)
n = 5 (1.47%)
Tryptophan (Trp, W)
n = 10 (2.94%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.47%)
Asparagine (Asn, N)
n = 14 (4.12%)
Glutamine (Gln, Q)
n = 10 (2.94%)
Histidine (His, H)
n = 3 (0.88%)
Lysine (Lys, K)
n = 14 (4.12%)
Arginine (Arg, R)
n = 4 (1.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 11 22 14 5 20 6 15 10 0 0 1 2 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 5 11 11 1 2 6 3 2 1 4 13 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 23 4 1 3 19 0 1 5 0 5 2 0 7 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 2 0 1 12 2 0 1 1 2 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 80 142 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 129 53 124
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 96 163 56
ND4 (size: 1365 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.74%)
Alanine (Ala, A)
n = 29 (6.39%)
Serine (Ser, S)
n = 33 (7.27%)
Threonine (Thr, T)
n = 45 (9.91%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 17 (3.74%)
Leucine (Leu, L)
n = 87 (19.16%)
Isoleucine (Ile, I)
n = 41 (9.03%)
Methionine (Met, M)
n = 36 (7.93%)
Proline (Pro, P)
n = 28 (6.17%)
Phenylalanine (Phe, F)
n = 13 (2.86%)
Tyrosine (Tyr, Y)
n = 17 (3.74%)
Tryptophan (Trp, W)
n = 9 (1.98%)
Aspartic acid (Asp, D)
n = 4 (0.88%)
Glutamic acid (Glu, E)
n = 9 (1.98%)
Asparagine (Asn, N)
n = 21 (4.63%)
Glutamine (Gln, Q)
n = 14 (3.08%)
Histidine (His, H)
n = 9 (1.98%)
Lysine (Lys, K)
n = 12 (2.64%)
Arginine (Arg, R)
n = 10 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 13 27 17 13 35 5 15 13 1 5 7 2 3 9 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 2 3 19 7 0 4 5 6 2 1 7 18 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 19 0 4 3 18 1 2 5 7 10 3 2 5 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 1 1 3 9 3 1 3 6 0 1 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 131 163 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 128 86 194
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 132 190 101
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.17%)
Alanine (Ala, A)
n = 2 (2.08%)
Serine (Ser, S)
n = 11 (11.46%)
Threonine (Thr, T)
n = 16 (16.67%)
Cysteine (Cys, C)
n = 3 (3.13%)
Valine (Val, V)
n = 4 (4.17%)
Leucine (Leu, L)
n = 21 (21.88%)
Isoleucine (Ile, I)
n = 7 (7.29%)
Methionine (Met, M)
n = 5 (5.21%)
Proline (Pro, P)
n = 2 (2.08%)
Phenylalanine (Phe, F)
n = 3 (3.13%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 8 (8.33%)
Glutamine (Gln, Q)
n = 1 (1.04%)
Histidine (His, H)
n = 3 (3.13%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 0 4 2 3 9 0 6 1 0 1 2 1 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 0 1 1 0 0 2 2 0 1 1 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 1 3 4 1 0 1 2 0 0 0 1 3 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 1 0 3 0 0 0 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
13 20 42 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 28 19 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 30 41 23
ND5 (size: 1785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (3.87%)
Alanine (Ala, A)
n = 46 (7.74%)
Serine (Ser, S)
n = 53 (8.92%)
Threonine (Thr, T)
n = 90 (15.15%)
Cysteine (Cys, C)
n = 3 (0.51%)
Valine (Val, V)
n = 13 (2.19%)
Leucine (Leu, L)
n = 95 (15.99%)
Isoleucine (Ile, I)
n = 50 (8.42%)
Methionine (Met, M)
n = 35 (5.89%)
Proline (Pro, P)
n = 24 (4.04%)
Phenylalanine (Phe, F)
n = 23 (3.87%)
Tyrosine (Tyr, Y)
n = 12 (2.02%)
Tryptophan (Trp, W)
n = 9 (1.52%)
Aspartic acid (Asp, D)
n = 11 (1.85%)
Glutamic acid (Glu, E)
n = 11 (1.85%)
Asparagine (Asn, N)
n = 31 (5.22%)
Glutamine (Gln, Q)
n = 16 (2.69%)
Histidine (His, H)
n = 13 (2.19%)
Lysine (Lys, K)
n = 28 (4.71%)
Arginine (Arg, R)
n = 8 (1.35%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 17 32 21 14 34 4 20 14 2 2 3 5 3 10 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 6 24 14 2 3 12 6 2 5 3 14 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 45 2 7 14 25 2 3 2 2 10 2 2 9 22 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 2 3 8 25 3 3 2 3 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 134 239 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 208 123 216
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 189 254 121
ND6 (size: 507 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.88%)
Alanine (Ala, A)
n = 13 (7.74%)
Serine (Ser, S)
n = 17 (10.12%)
Threonine (Thr, T)
n = 3 (1.79%)
Cysteine (Cys, C)
n = 6 (3.57%)
Valine (Val, V)
n = 24 (14.29%)
Leucine (Leu, L)
n = 24 (14.29%)
Isoleucine (Ile, I)
n = 9 (5.36%)
Methionine (Met, M)
n = 4 (2.38%)
Proline (Pro, P)
n = 3 (1.79%)
Phenylalanine (Phe, F)
n = 17 (10.12%)
Tyrosine (Tyr, Y)
n = 10 (5.95%)
Tryptophan (Trp, W)
n = 2 (1.19%)
Aspartic acid (Asp, D)
n = 3 (1.79%)
Glutamic acid (Glu, E)
n = 4 (2.38%)
Asparagine (Asn, N)
n = 1 (0.6%)
Glutamine (Gln, Q)
n = 1 (0.6%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.6%)
Arginine (Arg, R)
n = 1 (0.6%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 1 0 4 1 1 3 9 1 0 12 2 2 8 15 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 6 0 7 1 0 5 10 2 3 10 1 1 0 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 6 0 3 1 5 2 7 3 1 6 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 3 0 0 1 0 0 0 1 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 14 25 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 29 21 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 16 23 84
Total protein-coding genes (size: 11262 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 198 (5.28%)
Alanine (Ala, A)
n = 258 (6.88%)
Serine (Ser, S)
n = 283 (7.54%)
Threonine (Thr, T)
n = 439 (11.7%)
Cysteine (Cys, C)
n = 25 (0.67%)
Valine (Val, V)
n = 162 (4.32%)
Leucine (Leu, L)
n = 600 (15.99%)
Isoleucine (Ile, I)
n = 280 (7.46%)
Methionine (Met, M)
n = 225 (6.0%)
Proline (Pro, P)
n = 202 (5.38%)
Phenylalanine (Phe, F)
n = 213 (5.68%)
Tyrosine (Tyr, Y)
n = 111 (2.96%)
Tryptophan (Trp, W)
n = 98 (2.61%)
Aspartic acid (Asp, D)
n = 58 (1.55%)
Glutamic acid (Glu, E)
n = 86 (2.29%)
Asparagine (Asn, N)
n = 155 (4.13%)
Glutamine (Gln, Q)
n = 90 (2.4%)
Histidine (His, H)
n = 89 (2.37%)
Lysine (Lys, K)
n = 108 (2.88%)
Arginine (Arg, R)
n = 63 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
178 102 175 117 73 218 41 131 83 7 45 39 54 24 124 89
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
50 12 13 42 118 84 14 27 62 65 44 20 51 118 13 68
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
154 200 17 33 62 129 9 17 33 35 76 16 20 46 109 18
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
71 66 20 17 41 93 15 8 18 34 3 2 0 7 1 82
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
762 893 1259 839
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
436 1132 705 1480
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
294 1111 1541 807

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.