Viewing data for Branchiostegus japonicus


Scientific name Branchiostegus japonicus
Common name Red tilefish
Maximum lifespan 12.00 years (Branchiostegus japonicus@AnAge)

Total mtDNA (size: 16541 bases) GC AT G C A T
Base content (bases) 7662 8879 4958 2704 4213 4666
Base content per 1 kb (bases) 463 537 300 163 255 282
Base content (%) 46.3% 53.7%
Total protein-coding genes (size: 11401 bases) GC AT G C A T
Base content (bases) 5319 6082 3648 1671 3034 3048
Base content per 1 kb (bases) 467 533 320 147 266 267
Base content (%) 46.7% 53.3%
D-loop (size: 856 bases) GC AT G C A T
Base content (bases) 335 521 188 147 246 275
Base content per 1 kb (bases) 391 609 220 172 287 321
Base content (%) 39.1% 60.9%
Total tRNA-coding genes (size: 1562 bases) GC AT G C A T
Base content (bases) 709 853 394 315 375 478
Base content per 1 kb (bases) 454 546 252 202 240 306
Base content (%) 45.4% 54.6%
Total rRNA-coding genes (size: 2651 bases) GC AT G C A T
Base content (bases) 1263 1388 705 558 542 846
Base content per 1 kb (bases) 476 524 266 210 204 319
Base content (%) 47.6% 52.4%
12S rRNA gene (size: 949 bases) GC AT G C A T
Base content (bases) 463 486 248 215 199 287
Base content per 1 kb (bases) 488 512 261 227 210 302
Base content (%) 48.8% 51.2%
16S rRNA gene (size: 1702 bases) GC AT G C A T
Base content (bases) 800 902 457 343 343 559
Base content per 1 kb (bases) 470 530 269 202 202 328
Base content (%) 47.0% 53.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 320 364 218 102 189 175
Base content per 1 kb (bases) 468 532 319 149 276 256
Base content (%) 46.8% 53.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 64 104 46 18 46 58
Base content per 1 kb (bases) 381 619 274 107 274 345
Base content (%) 38.1% 61.9%
COX1 (size: 1543 bases) GC AT G C A T
Base content (bases) 697 846 422 275 461 385
Base content per 1 kb (bases) 452 548 273 178 299 250
Base content (%) 45.2% 54.8%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 315 376 206 109 184 192
Base content per 1 kb (bases) 456 544 298 158 266 278
Base content (%) 45.6% 54.4%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 369 416 240 129 220 196
Base content per 1 kb (bases) 470 530 306 164 280 250
Base content (%) 47.0% 53.0%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 509 632 349 160 329 303
Base content per 1 kb (bases) 446 554 306 140 288 266
Base content (%) 44.6% 55.4%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 460 515 313 147 256 259
Base content per 1 kb (bases) 472 528 321 151 263 266
Base content (%) 47.2% 52.8%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 522 524 390 132 254 270
Base content per 1 kb (bases) 499 501 373 126 243 258
Base content (%) 49.9% 50.1%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 175 174 130 45 101 73
Base content per 1 kb (bases) 501 499 372 129 289 209
Base content (%) 50.1% 49.9%
ND4 (size: 1383 bases) GC AT G C A T
Base content (bases) 661 722 465 196 350 372
Base content per 1 kb (bases) 478 522 336 142 253 269
Base content (%) 47.8% 52.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 155 142 107 48 81 61
Base content per 1 kb (bases) 522 478 360 162 273 205
Base content (%) 52.2% 47.8%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 837 1002 590 247 491 511
Base content per 1 kb (bases) 455 545 321 134 267 278
Base content (%) 45.5% 54.5%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 242 280 175 67 79 201
Base content per 1 kb (bases) 464 536 335 128 151 385
Base content (%) 46.4% 53.6%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 9 (3.96%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 20 (8.81%)
Leucine (Leu, L)
n = 57 (25.11%)
Isoleucine (Ile, I)
n = 14 (6.17%)
Methionine (Met, M)
n = 5 (2.2%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 6 (2.64%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 5 (2.2%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 4 3 7 17 20 7 6 9 0 6 5 5 4 9 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 8 6 1 0 3 4 2 3 10 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 3 1 1 1 1 1 4 2 3 1 0 2 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 2 0 2 0 0 0 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 85 55 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 36 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 73 84 50
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPLCWFNMLAFSWVAFTTIIPTKIKNVSFPNFPELKETDKPKTKSWTWPWL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 1 (1.82%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 5 (9.09%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 6 (10.91%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 1 2 1 1 0 1 1 0 0 0 2 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 1 0 0 0 0 0 0 2 2 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 2 1 0 0 0 0 0 0 1 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 1 0 1 4 2 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 12 21 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 18 15 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 16 22 13
COX1 (size: 1543 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.77%)
Alanine (Ala, A)
n = 46 (8.97%)
Serine (Ser, S)
n = 26 (5.07%)
Threonine (Thr, T)
n = 42 (8.19%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.8%)
Leucine (Leu, L)
n = 64 (12.48%)
Isoleucine (Ile, I)
n = 35 (6.82%)
Methionine (Met, M)
n = 23 (4.48%)
Proline (Pro, P)
n = 31 (6.04%)
Phenylalanine (Phe, F)
n = 42 (8.19%)
Tyrosine (Tyr, Y)
n = 18 (3.51%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 11 (2.14%)
Asparagine (Asn, N)
n = 14 (2.73%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 19 (3.7%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 11 11 15 12 15 5 16 6 1 11 7 18 4 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 1 9 19 17 1 8 15 14 8 10 13 7 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 23 0 5 12 5 0 0 4 9 9 2 1 6 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 5 8 7 8 1 4 0 4 1 0 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
157 113 127 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 141 93 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 168 165 139
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 30 (13.1%)
Isoleucine (Ile, I)
n = 20 (8.73%)
Methionine (Met, M)
n = 10 (4.37%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 14 (6.11%)
Glutamic acid (Glu, E)
n = 12 (5.24%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 10 (4.37%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 10 8 8 5 9 1 6 9 1 5 5 9 2 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 9 6 0 3 3 2 1 5 4 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 2 9 1 0 1 3 3 6 0 1 1 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 1 2 12 2 1 0 5 1 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 63 51 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 53 62 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 90 79 51
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (8.85%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 5 6 6 7 15 1 3 7 0 8 6 3 1 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 1 14 5 0 3 8 10 2 6 6 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 2 2 4 4 0 0 3 5 8 1 1 0 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 0 1 4 2 0 0 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 70 52 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 66 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 104 89 58
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 24 (6.33%)
Leucine (Leu, L)
n = 62 (16.36%)
Isoleucine (Ile, I)
n = 28 (7.39%)
Methionine (Met, M)
n = 12 (3.17%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 20 (5.28%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 13 8 9 20 19 2 11 5 1 10 8 5 1 10 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 6 7 11 1 1 10 12 3 3 10 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 9 0 2 8 14 0 0 2 6 9 2 1 2 18 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 1 1 9 7 2 0 1 7 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 96 96 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 95 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 158 131 73
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 35 (10.8%)
Serine (Ser, S)
n = 19 (5.86%)
Threonine (Thr, T)
n = 17 (5.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 23 (7.1%)
Leucine (Leu, L)
n = 65 (20.06%)
Isoleucine (Ile, I)
n = 25 (7.72%)
Methionine (Met, M)
n = 10 (3.09%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 7 (2.16%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 10 (3.09%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 8 (2.47%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 15 7 11 16 27 4 7 4 2 3 9 10 1 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 16 12 3 0 7 8 3 4 10 9 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 2 6 8 0 0 3 5 6 1 0 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 2 1 3 8 0 1 1 6 0 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 100 75 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 92 56 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 121 128 55
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 40 (11.53%)
Serine (Ser, S)
n = 27 (7.78%)
Threonine (Thr, T)
n = 42 (12.1%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 72 (20.75%)
Isoleucine (Ile, I)
n = 19 (5.48%)
Methionine (Met, M)
n = 18 (5.19%)
Proline (Pro, P)
n = 23 (6.63%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 11 14 27 19 4 6 12 3 1 7 1 0 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 10 18 11 1 1 8 9 0 4 13 5 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 15 1 5 13 5 0 1 3 3 4 0 2 2 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 1 0 3 7 1 0 1 2 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 113 100 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 128 53 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 149 116 61
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 40 (11.53%)
Serine (Ser, S)
n = 27 (7.78%)
Threonine (Thr, T)
n = 42 (12.1%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 72 (20.75%)
Isoleucine (Ile, I)
n = 19 (5.48%)
Methionine (Met, M)
n = 18 (5.19%)
Proline (Pro, P)
n = 23 (6.63%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 11 14 27 19 4 6 12 3 1 7 1 0 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 10 18 11 1 1 8 9 0 4 13 5 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 15 1 5 13 5 0 1 3 3 4 0 2 2 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 1 0 3 7 1 0 1 2 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 113 100 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 128 53 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 149 116 61
ND4 (size: 1383 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (5.43%)
Alanine (Ala, A)
n = 41 (8.91%)
Serine (Ser, S)
n = 34 (7.39%)
Threonine (Thr, T)
n = 40 (8.7%)
Cysteine (Cys, C)
n = 3 (0.65%)
Valine (Val, V)
n = 16 (3.48%)
Leucine (Leu, L)
n = 95 (20.65%)
Isoleucine (Ile, I)
n = 32 (6.96%)
Methionine (Met, M)
n = 27 (5.87%)
Proline (Pro, P)
n = 26 (5.65%)
Phenylalanine (Phe, F)
n = 18 (3.91%)
Tyrosine (Tyr, Y)
n = 16 (3.48%)
Tryptophan (Trp, W)
n = 18 (3.91%)
Aspartic acid (Asp, D)
n = 2 (0.43%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 11 (2.39%)
Glutamine (Gln, Q)
n = 11 (2.39%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 20 23 13 23 35 6 14 9 2 3 5 6 2 4 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 5 20 14 2 4 12 6 3 1 20 4 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 16 2 6 15 6 0 1 6 6 10 3 4 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 5 0 2 8 1 1 3 8 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 138 126 101
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 134 74 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 193 172 61
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 4 1 8 5 4 2 3 0 1 1 2 0 6 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 8 4 0 2 3 0 0 1 0 0 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 1 0 0 4 4 0 0 2 0 0 0 2 0 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 2 1 0 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 30 19 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 31 13 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 46 29 15
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.9%)
Alanine (Ala, A)
n = 58 (9.48%)
Serine (Ser, S)
n = 43 (7.03%)
Threonine (Thr, T)
n = 59 (9.64%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 26 (4.25%)
Leucine (Leu, L)
n = 99 (16.18%)
Isoleucine (Ile, I)
n = 45 (7.35%)
Methionine (Met, M)
n = 30 (4.9%)
Proline (Pro, P)
n = 30 (4.9%)
Phenylalanine (Phe, F)
n = 41 (6.7%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 33 (5.39%)
Glutamine (Gln, Q)
n = 17 (2.78%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 25 24 25 24 27 9 12 14 3 8 12 5 1 15 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 3 9 31 18 0 4 10 12 4 9 14 6 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 19 1 5 16 8 1 1 12 2 10 3 2 12 21 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 3 5 7 17 3 1 3 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
138 157 200 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 177 123 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 256 188 132
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (17.92%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 20 (11.56%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 9 (5.2%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 3 8 0 0 1 7 0 1 12 0 6 2 11 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 0 6 2 6 3 9 4 4 14 3 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 5 0 2 2 1 3 7 1 2 11 1 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 5 1 1 0 0 1 0 2 2 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 21 22 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 35 21 70
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 11 36 76
Total protein-coding genes (size: 11423 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 245 (6.44%)
Alanine (Ala, A)
n = 341 (8.96%)
Serine (Ser, S)
n = 247 (6.49%)
Threonine (Thr, T)
n = 303 (7.97%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 226 (5.94%)
Leucine (Leu, L)
n = 661 (17.38%)
Isoleucine (Ile, I)
n = 249 (6.55%)
Methionine (Met, M)
n = 162 (4.26%)
Proline (Pro, P)
n = 219 (5.76%)
Phenylalanine (Phe, F)
n = 237 (6.23%)
Tyrosine (Tyr, Y)
n = 116 (3.05%)
Tryptophan (Trp, W)
n = 118 (3.1%)
Aspartic acid (Asp, D)
n = 75 (1.97%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 123 (3.23%)
Glutamine (Gln, Q)
n = 96 (2.52%)
Histidine (His, H)
n = 106 (2.79%)
Lysine (Lys, K)
n = 77 (2.02%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
127 122 110 129 172 199 44 92 82 14 68 68 72 18 102 135
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
52 8 18 58 160 111 12 35 86 84 40 51 108 54 6 49
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
122 120 12 38 94 60 4 6 45 50 66 16 25 33 90 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
84 70 25 21 54 66 11 8 19 45 4 0 0 5 2 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
982 1041 965 817
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
516 1059 695 1535
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
285 1443 1272 805

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.