Viewing data for Ambystoma texanum


Scientific name Ambystoma texanum
Common name Smallmouth salamander
Maximum lifespan 13.80 years (Ambystoma texanum@AnAge)

Total mtDNA (size: 16367 bases) GC AT G C A T
Base content (bases) 5540 10827 3352 2188 5175 5652
Base content per 1 kb (bases) 338 662 205 134 316 345
Base content (%) 33.8% 66.2%
Total protein-coding genes (size: 11326 bases) GC AT G C A T
Base content (bases) 3769 7557 2368 1401 3759 3798
Base content per 1 kb (bases) 333 667 209 124 332 335
Base content (%) 33.3% 66.7%
D-loop (size: 743 bases) GC AT G C A T
Base content (bases) 277 466 161 116 242 224
Base content per 1 kb (bases) 373 627 217 156 326 301
Base content (%) 37.3% 62.7%
Total tRNA-coding genes (size: 1540 bases) GC AT G C A T
Base content (bases) 508 1032 289 219 465 567
Base content per 1 kb (bases) 330 670 188 142 302 368
Base content (%) 33.0% 67.0%
Total rRNA-coding genes (size: 2479 bases) GC AT G C A T
Base content (bases) 868 1611 459 409 624 987
Base content per 1 kb (bases) 350 650 185 165 252 398
Base content (%) 35.0% 65.0%
12S rRNA gene (size: 924 bases) GC AT G C A T
Base content (bases) 353 571 189 164 216 355
Base content per 1 kb (bases) 382 618 205 177 234 384
Base content (%) 38.2% 61.8%
16S rRNA gene (size: 1555 bases) GC AT G C A T
Base content (bases) 515 1040 270 245 408 632
Base content per 1 kb (bases) 331 669 174 158 262 406
Base content (%) 33.1% 66.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 228 456 152 76 237 219
Base content per 1 kb (bases) 333 667 222 111 346 320
Base content (%) 33.3% 66.7%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 46 122 34 12 51 71
Base content per 1 kb (bases) 274 726 202 71 304 423
Base content (%) 27.4% 72.6%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 561 987 311 250 530 457
Base content per 1 kb (bases) 362 638 201 161 342 295
Base content (%) 36.2% 63.8%
COX2 (size: 686 bases) GC AT G C A T
Base content (bases) 236 450 136 100 211 239
Base content per 1 kb (bases) 344 656 198 146 308 348
Base content (%) 34.4% 65.6%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 306 479 176 130 245 234
Base content per 1 kb (bases) 390 610 224 166 312 298
Base content (%) 39.0% 61.0%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 383 758 246 137 395 363
Base content per 1 kb (bases) 336 664 216 120 346 318
Base content (%) 33.6% 66.4%
ND1 (size: 969 bases) GC AT G C A T
Base content (bases) 320 649 201 119 341 308
Base content per 1 kb (bases) 330 670 207 123 352 318
Base content (%) 33.0% 67.0%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 316 726 216 100 343 383
Base content per 1 kb (bases) 303 697 207 96 329 368
Base content (%) 30.3% 69.7%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 117 234 72 45 129 105
Base content per 1 kb (bases) 333 667 205 128 368 299
Base content (%) 33.3% 66.7%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 447 928 287 160 463 465
Base content per 1 kb (bases) 325 675 209 116 337 338
Base content (%) 32.5% 67.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 97 200 62 35 108 92
Base content per 1 kb (bases) 327 673 209 118 364 310
Base content (%) 32.7% 67.3%
ND5 (size: 1800 bases) GC AT G C A T
Base content (bases) 566 1234 370 196 612 622
Base content per 1 kb (bases) 314 686 206 109 340 346
Base content (%) 31.4% 68.6%
ND6 (size: 516 bases) GC AT G C A T
Base content (bases) 159 357 113 46 102 255
Base content per 1 kb (bases) 308 692 219 89 198 494
Base content (%) 30.8% 69.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 10 (4.41%)
Threonine (Thr, T)
n = 27 (11.89%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 54 (23.79%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 1 10 12 2 16 2 22 8 0 5 3 2 1 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 6 1 8 0 1 3 4 1 2 0 10 3 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 0 1 1 4 0 1 3 4 0 3 0 6 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 1 1 3 0 1 1 2 1 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 63 74 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 63 34 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 26 111 79
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPGPWLAILVMSWFTYLFILMSKTNNFKYNNDPNMQNVKKMKPQSWNWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 5 (9.09%)
Proline (Pro, P)
n = 6 (10.91%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 8 (14.55%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 4 1 0 1 0 3 3 0 1 0 1 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 1 0 0 2 1 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 3 0 0 0 0 0 1 1 0 0 5 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 1 5 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 11 23 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 13 20 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 10 28 17
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.74%)
Alanine (Ala, A)
n = 43 (8.35%)
Serine (Ser, S)
n = 36 (6.99%)
Threonine (Thr, T)
n = 36 (6.99%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.96%)
Leucine (Leu, L)
n = 61 (11.84%)
Isoleucine (Ile, I)
n = 38 (7.38%)
Methionine (Met, M)
n = 29 (5.63%)
Proline (Pro, P)
n = 26 (5.05%)
Phenylalanine (Phe, F)
n = 40 (7.77%)
Tyrosine (Tyr, Y)
n = 17 (3.3%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 7 28 14 0 17 4 26 6 1 12 3 24 2 33 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 12 11 18 2 11 10 22 2 5 5 11 5 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 19 1 11 3 17 1 1 3 14 3 1 0 10 6 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 0 8 7 8 0 0 0 9 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 97 131 134
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 137 94 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 77 232 187
COX2 (size: 686 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 22 (9.69%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 1 14 4 0 4 0 14 9 0 4 2 5 2 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 5 3 6 1 2 0 4 2 4 0 8 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 7 1 3 1 9 0 1 4 5 3 1 0 4 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 13 1 8 3 3 0 0 0 6 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 46 70 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 58 62 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 32 106 77
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 7 (2.69%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 3 9 7 0 8 1 19 8 0 4 5 7 0 16 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 5 4 11 1 2 6 5 7 0 0 11 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 15 1 3 1 8 0 0 3 5 5 1 0 3 1 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 2 2 5 2 0 1 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 55 54 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 65 54 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 56 125 65
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 20 (5.28%)
Serine (Ser, S)
n = 28 (7.39%)
Threonine (Thr, T)
n = 23 (6.07%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 12 (3.17%)
Leucine (Leu, L)
n = 49 (12.93%)
Isoleucine (Ile, I)
n = 44 (11.61%)
Methionine (Met, M)
n = 22 (5.8%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 34 (8.97%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 9 18 9 3 12 2 23 9 0 2 1 9 0 23 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 7 3 10 0 3 7 13 3 4 3 13 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 0 8 7 11 0 1 1 6 7 1 0 10 8 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 1 4 4 10 0 0 1 7 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 77 119 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 91 77 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 78 167 122
ND1 (size: 969 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 22 (6.83%)
Serine (Ser, S)
n = 24 (7.45%)
Threonine (Thr, T)
n = 26 (8.07%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.04%)
Leucine (Leu, L)
n = 58 (18.01%)
Isoleucine (Ile, I)
n = 25 (7.76%)
Methionine (Met, M)
n = 20 (6.21%)
Proline (Pro, P)
n = 21 (6.52%)
Phenylalanine (Phe, F)
n = 21 (6.52%)
Tyrosine (Tyr, Y)
n = 12 (3.73%)
Tryptophan (Trp, W)
n = 7 (2.17%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 17 (5.28%)
Glutamine (Gln, Q)
n = 8 (2.48%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 4 17 12 0 18 0 26 7 1 5 1 7 0 17 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 3 8 10 1 2 1 6 7 8 3 9 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 9 2 7 1 14 1 0 1 9 3 1 2 9 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 9 2 3 0 7 0 2 1 5 0 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 69 96 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 92 61 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 40 151 111
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 23 (6.65%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 39 (11.27%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 16 (4.62%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 8 36 10 1 12 2 29 9 0 1 3 1 0 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 5 5 13 0 2 3 5 4 4 1 9 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 18 2 6 4 17 0 2 2 3 3 1 2 10 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 3 0 10 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 62 147 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 102 59 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 52 177 102
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 23 (6.65%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 39 (11.27%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 16 (4.62%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 8 36 10 1 12 2 29 9 0 1 3 1 0 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 5 5 13 0 2 3 5 4 4 1 9 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 18 2 6 4 17 0 2 2 3 3 1 2 10 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 3 0 10 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 62 147 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 102 59 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 52 177 102
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.6%)
Alanine (Ala, A)
n = 28 (6.13%)
Serine (Ser, S)
n = 33 (7.22%)
Threonine (Thr, T)
n = 36 (7.88%)
Cysteine (Cys, C)
n = 8 (1.75%)
Valine (Val, V)
n = 16 (3.5%)
Leucine (Leu, L)
n = 88 (19.26%)
Isoleucine (Ile, I)
n = 40 (8.75%)
Methionine (Met, M)
n = 33 (7.22%)
Proline (Pro, P)
n = 23 (5.03%)
Phenylalanine (Phe, F)
n = 23 (5.03%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 13 (2.84%)
Asparagine (Asn, N)
n = 18 (3.94%)
Glutamine (Gln, Q)
n = 12 (2.63%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 14 (3.06%)
Arginine (Arg, R)
n = 11 (2.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 8 30 24 5 18 1 38 12 0 5 2 9 0 17 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 4 4 5 8 14 1 4 3 12 2 3 2 16 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 19 3 3 2 20 0 4 4 12 3 2 2 8 10 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 12 1 1 1 14 0 3 1 6 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 104 149 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 112 84 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 71 232 137
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 9 (9.18%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 1 7 7 1 0 0 11 2 0 2 0 0 0 7 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 0 4 5 0 0 1 2 1 0 0 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 6 1 2 0 5 0 1 1 0 0 0 0 2 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 1 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 19 32 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 27 14 46
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 16 46 32
ND5 (size: 1800 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.51%)
Alanine (Ala, A)
n = 41 (6.84%)
Serine (Ser, S)
n = 53 (8.85%)
Threonine (Thr, T)
n = 46 (7.68%)
Cysteine (Cys, C)
n = 6 (1.0%)
Valine (Val, V)
n = 15 (2.5%)
Leucine (Leu, L)
n = 87 (14.52%)
Isoleucine (Ile, I)
n = 65 (10.85%)
Methionine (Met, M)
n = 39 (6.51%)
Proline (Pro, P)
n = 24 (4.01%)
Phenylalanine (Phe, F)
n = 41 (6.84%)
Tyrosine (Tyr, Y)
n = 20 (3.34%)
Tryptophan (Trp, W)
n = 13 (2.17%)
Aspartic acid (Asp, D)
n = 13 (2.17%)
Glutamic acid (Glu, E)
n = 13 (2.17%)
Asparagine (Asn, N)
n = 34 (5.68%)
Glutamine (Gln, Q)
n = 22 (3.67%)
Histidine (His, H)
n = 8 (1.34%)
Lysine (Lys, K)
n = 23 (3.84%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
50 15 34 13 9 19 3 41 22 0 5 0 10 0 28 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 3 9 12 20 0 4 5 11 7 9 2 13 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 27 1 18 3 23 1 4 4 11 9 1 2 20 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 11 2 7 6 22 1 1 1 7 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 107 216 168
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 156 133 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 107 273 197
ND6 (size: 516 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (11.11%)
Alanine (Ala, A)
n = 15 (8.77%)
Serine (Ser, S)
n = 15 (8.77%)
Threonine (Thr, T)
n = 2 (1.17%)
Cysteine (Cys, C)
n = 4 (2.34%)
Valine (Val, V)
n = 20 (11.7%)
Leucine (Leu, L)
n = 27 (15.79%)
Isoleucine (Ile, I)
n = 7 (4.09%)
Methionine (Met, M)
n = 11 (6.43%)
Proline (Pro, P)
n = 4 (2.34%)
Phenylalanine (Phe, F)
n = 17 (9.94%)
Tyrosine (Tyr, Y)
n = 12 (7.02%)
Tryptophan (Trp, W)
n = 3 (1.75%)
Aspartic acid (Asp, D)
n = 4 (2.34%)
Glutamic acid (Glu, E)
n = 4 (2.34%)
Asparagine (Asn, N)
n = 3 (1.75%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 0 7 1 0 1 0 23 0 0 15 0 4 1 16 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 4 0 6 0 4 5 11 1 4 3 2 0 1 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 11 0 2 0 2 0 12 0 0 2 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 4 0 0 0 2 0 1 0 1 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 10 26 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 34 24 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 2 52 99
Total protein-coding genes (size: 11362 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.68%)
Alanine (Ala, A)
n = 260 (6.87%)
Serine (Ser, S)
n = 284 (7.51%)
Threonine (Thr, T)
n = 285 (7.53%)
Cysteine (Cys, C)
n = 33 (0.87%)
Valine (Val, V)
n = 168 (4.44%)
Leucine (Leu, L)
n = 589 (15.57%)
Isoleucine (Ile, I)
n = 336 (8.88%)
Methionine (Met, M)
n = 252 (6.66%)
Proline (Pro, P)
n = 194 (5.13%)
Phenylalanine (Phe, F)
n = 251 (6.63%)
Tyrosine (Tyr, Y)
n = 121 (3.2%)
Tryptophan (Trp, W)
n = 110 (2.91%)
Aspartic acid (Asp, D)
n = 74 (1.96%)
Glutamic acid (Glu, E)
n = 96 (2.54%)
Asparagine (Asn, N)
n = 160 (4.23%)
Glutamine (Gln, Q)
n = 99 (2.62%)
Histidine (His, H)
n = 91 (2.4%)
Lysine (Lys, K)
n = 87 (2.3%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
275 61 218 119 21 135 15 288 97 2 61 20 81 6 194 57
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
34 17 16 67 60 122 11 42 43 91 39 44 17 112 21 72
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
48 153 12 81 23 132 3 17 28 83 38 12 11 92 68 45
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
46 83 13 41 33 86 1 10 6 54 2 2 0 5 1 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
813 746 1167 1059
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
477 978 734 1596
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
183 585 1757 1260

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.