Viewing data for Himatione sanguinea


Scientific name Himatione sanguinea
Common name Apapane
Maximum lifespan 11.00 years (Himatione sanguinea@AnAge)

Total mtDNA (size: 16840 bases) GC AT G C A T
Base content (bases) 7693 9137 5248 2445 4066 5071
Base content per 1 kb (bases) 457 543 312 145 241 301
Base content (%) 45.7% 54.3%
Total protein-coding genes (size: 11388 bases) GC AT G C A T
Base content (bases) 5313 6070 3828 1485 2737 3333
Base content per 1 kb (bases) 467 533 336 130 240 293
Base content (%) 46.7% 53.3%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1542 bases) GC AT G C A T
Base content (bases) 641 900 374 267 396 504
Base content per 1 kb (bases) 416 584 243 173 257 327
Base content (%) 41.6% 58.4%
Total rRNA-coding genes (size: 2571 bases) GC AT G C A T
Base content (bases) 1166 1405 642 524 558 847
Base content per 1 kb (bases) 454 546 250 204 217 329
Base content (%) 45.4% 54.6%
12S rRNA gene (size: 972 bases) GC AT G C A T
Base content (bases) 467 505 259 208 208 297
Base content per 1 kb (bases) 480 520 266 214 214 306
Base content (%) 48.0% 52.0%
16S rRNA gene (size: 1599 bases) GC AT G C A T
Base content (bases) 699 900 383 316 350 550
Base content per 1 kb (bases) 437 563 240 198 219 344
Base content (%) 43.7% 56.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 311 373 239 72 168 205
Base content per 1 kb (bases) 455 545 349 105 246 300
Base content (%) 45.5% 54.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 77 91 62 15 44 47
Base content per 1 kb (bases) 458 542 369 89 262 280
Base content (%) 45.8% 54.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 735 814 470 265 393 421
Base content per 1 kb (bases) 474 525 303 171 253 271
Base content (%) 47.4% 52.5%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 320 364 215 105 155 209
Base content per 1 kb (bases) 467 531 314 153 226 305
Base content (%) 46.7% 53.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 386 398 260 126 191 207
Base content per 1 kb (bases) 492 508 332 161 244 264
Base content (%) 49.2% 50.8%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 548 594 391 157 275 319
Base content per 1 kb (bases) 479 520 342 137 241 279
Base content (%) 47.9% 52.0%
ND1 (size: 987 bases) GC AT G C A T
Base content (bases) 449 537 307 142 276 261
Base content per 1 kb (bases) 455 544 311 144 280 264
Base content (%) 45.5% 54.4%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 464 576 351 113 269 307
Base content per 1 kb (bases) 446 554 338 109 259 295
Base content (%) 44.6% 55.4%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 152 199 110 42 97 102
Base content per 1 kb (bases) 433 567 313 120 276 291
Base content (%) 43.3% 56.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 646 732 494 152 312 420
Base content per 1 kb (bases) 469 531 358 110 226 305
Base content (%) 46.9% 53.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 149 148 107 42 73 75
Base content per 1 kb (bases) 502 498 360 141 246 253
Base content (%) 50.2% 49.8%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 831 987 623 208 424 563
Base content per 1 kb (bases) 457 543 343 114 233 310
Base content (%) 45.7% 54.3%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 250 269 202 48 64 205
Base content per 1 kb (bases) 482 518 389 92 123 395
Base content (%) 48.2% 51.8%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 15 4 3 13 33 5 7 8 0 1 4 4 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 7 4 0 1 5 2 0 2 5 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 1 1 4 5 1 0 4 1 2 0 0 1 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 3 4 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 86 66 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 88 104 24
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMIISWLTFSLIIQPKLLSFVSMNPPSNKRPVAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 1 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 1 1 2 1 1 0 2 0 0 1 0 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 1 0 0 0 0 0 5 2 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 0 0 0 2 3 0 0 1 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 1 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 19 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 22 8 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 22 20 10
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 44 (8.53%)
Serine (Ser, S)
n = 29 (5.62%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.14%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 28 16 8 11 36 6 2 9 0 7 14 19 2 7 36
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 5 23 16 0 8 9 21 9 4 8 15 3 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 0 6 8 11 0 0 4 3 14 1 0 5 10 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 1 2 13 9 0 3 0 5 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
158 127 126 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 136 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 206 201 80
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 23 (10.13%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 28 (12.33%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 11 10 4 6 13 2 3 5 1 2 6 6 2 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 3 8 6 0 0 2 6 1 1 4 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 8 0 4 7 5 1 0 6 1 6 0 0 0 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 0 2 11 4 0 1 2 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 58 60 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 61 56 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 96 92 29
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 13 (5.0%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 11 4 3 7 20 2 1 7 2 2 6 8 1 2 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 0 13 9 0 1 8 9 2 4 4 4 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 0 6 5 3 0 0 4 2 8 0 0 1 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 1 0 5 4 0 1 1 3 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 74 54 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 70 54 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 116 99 34
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 21 (5.53%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 25 (6.58%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 33 (8.68%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 22 (5.79%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 25 6 3 18 34 8 0 8 0 4 7 12 2 0 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 6 13 7 2 3 7 11 3 4 9 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 1 4 9 7 0 0 1 0 12 0 0 6 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 1 7 9 0 1 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
92 115 98 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 98 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 177 141 45
ND1 (size: 987 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.96%)
Alanine (Ala, A)
n = 31 (9.45%)
Serine (Ser, S)
n = 26 (7.93%)
Threonine (Thr, T)
n = 19 (5.79%)
Cysteine (Cys, C)
n = 3 (0.91%)
Valine (Val, V)
n = 16 (4.88%)
Leucine (Leu, L)
n = 67 (20.43%)
Isoleucine (Ile, I)
n = 23 (7.01%)
Methionine (Met, M)
n = 11 (3.35%)
Proline (Pro, P)
n = 24 (7.32%)
Phenylalanine (Phe, F)
n = 17 (5.18%)
Tyrosine (Tyr, Y)
n = 15 (4.57%)
Tryptophan (Trp, W)
n = 8 (2.44%)
Aspartic acid (Asp, D)
n = 4 (1.22%)
Glutamic acid (Glu, E)
n = 11 (3.35%)
Asparagine (Asn, N)
n = 14 (4.27%)
Glutamine (Gln, Q)
n = 6 (1.83%)
Histidine (His, H)
n = 4 (1.22%)
Lysine (Lys, K)
n = 8 (2.44%)
Arginine (Arg, R)
n = 8 (2.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 10 6 10 13 26 4 11 3 3 3 3 6 4 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 6 11 11 3 2 7 4 0 5 11 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 1 4 8 8 0 1 5 4 11 0 3 3 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 4 1 3 7 1 2 1 5 0 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 94 82 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 93 62 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 118 117 65
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 25 (7.25%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 42 (12.17%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 31 (8.99%)
Methionine (Met, M)
n = 21 (6.09%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 18 12 13 19 21 6 7 8 2 1 7 2 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 4 9 12 0 0 6 5 1 5 9 7 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 13 1 5 10 8 3 1 5 2 5 1 1 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 1 0 1 12 2 0 2 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 103 126 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 114 58 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 134 122 63
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 25 (7.25%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 42 (12.17%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 31 (8.99%)
Methionine (Met, M)
n = 21 (6.09%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 18 12 13 19 21 6 7 8 2 1 7 2 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 4 9 12 0 0 6 5 1 5 9 7 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 13 1 5 10 8 3 1 5 2 5 1 1 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 1 0 1 12 2 0 2 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 103 126 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 114 58 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 134 122 63
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.15%)
Alanine (Ala, A)
n = 41 (8.95%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 99 (21.62%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 23 (5.02%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 33 19 6 28 52 4 9 14 0 0 7 3 2 0 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 7 17 17 0 2 8 7 2 5 11 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 15 1 2 14 12 0 0 8 1 12 0 0 0 17 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 0 0 2 10 0 1 0 8 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 156 141 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 137 80 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 201 199 44
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 15 (15.31%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 4 2 2 10 3 1 3 0 0 1 2 0 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 7 1 0 0 3 1 0 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 1 5 5 0 1 3 0 3 0 1 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 1 1 0 1 0 0 0 1 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 30 24 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 48 33 9
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 49 (8.1%)
Serine (Ser, S)
n = 56 (9.26%)
Threonine (Thr, T)
n = 65 (10.74%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 101 (16.69%)
Isoleucine (Ile, I)
n = 57 (9.42%)
Methionine (Met, M)
n = 27 (4.46%)
Proline (Pro, P)
n = 30 (4.96%)
Phenylalanine (Phe, F)
n = 37 (6.12%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 25 (4.13%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 42 25 9 21 59 6 6 16 1 2 5 9 1 1 36
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 6 6 27 16 0 1 9 22 1 6 16 8 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 23 1 5 22 16 1 1 11 2 11 2 0 5 20 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 1 0 8 20 1 1 1 6 0 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
119 161 208 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 188 107 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 274 248 67
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (18.6%)
Alanine (Ala, A)
n = 13 (7.56%)
Serine (Ser, S)
n = 14 (8.14%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 32 (18.6%)
Leucine (Leu, L)
n = 31 (18.02%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 9 (5.23%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 5 0 1 2 7 0 0 15 0 3 14 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 5 0 3 5 7 0 7 18 0 0 2 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 6 1 2 2 3 0 6 1 2 16 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 3 0 0 0 0 0 0 4 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 16 16 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 30 18 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
73 2 30 68
Total protein-coding genes (size: 11405 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 226 (5.95%)
Alanine (Ala, A)
n = 304 (8.0%)
Serine (Ser, S)
n = 299 (7.87%)
Threonine (Thr, T)
n = 310 (8.16%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 202 (5.32%)
Leucine (Leu, L)
n = 668 (17.58%)
Isoleucine (Ile, I)
n = 292 (7.69%)
Methionine (Met, M)
n = 159 (4.19%)
Proline (Pro, P)
n = 220 (5.79%)
Phenylalanine (Phe, F)
n = 218 (5.74%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 90 (2.37%)
Asparagine (Asn, N)
n = 135 (3.55%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 86 (2.26%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
88 204 113 71 146 324 49 57 86 9 37 61 75 29 36 182
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 6 22 49 140 105 10 25 64 99 38 41 83 89 6 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
123 118 8 44 99 88 8 7 53 22 87 7 21 27 108 20
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
82 77 13 9 57 82 4 10 12 43 7 2 1 5 1 100
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
888 1078 1045 785
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
496 1072 689 1539
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
257 1523 1463 553

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.