Viewing data for Caiman crocodilus


Scientific name Caiman crocodilus
Common name Spectacled caiman
Maximum lifespan 24.10 years (Caiman crocodilus@AnAge)

Total mtDNA (size: 17900 bases) GC AT G C A T
Base content (bases) 7616 10284 5422 2194 4471 5813
Base content per 1 kb (bases) 425 575 303 123 250 325
Base content (%) 42.5% 57.5%
Total protein-coding genes (size: 11360 bases) GC AT G C A T
Base content (bases) 5046 6314 3782 1264 2762 3552
Base content per 1 kb (bases) 444 556 333 111 243 313
Base content (%) 44.4% 55.6%
D-loop (size: 1992 bases) GC AT G C A T
Base content (bases) 566 1426 421 145 726 700
Base content per 1 kb (bases) 284 716 211 73 364 351
Base content (%) 28.4% 71.6%
Total tRNA-coding genes (size: 1561 bases) GC AT G C A T
Base content (bases) 687 874 417 270 367 507
Base content per 1 kb (bases) 440 560 267 173 235 325
Base content (%) 44.0% 56.0%
Total rRNA-coding genes (size: 2580 bases) GC AT G C A T
Base content (bases) 1169 1411 685 484 526 885
Base content per 1 kb (bases) 453 547 266 188 204 343
Base content (%) 45.3% 54.7%
12S rRNA gene (size: 988 bases) GC AT G C A T
Base content (bases) 481 507 271 210 190 317
Base content per 1 kb (bases) 487 513 274 213 192 321
Base content (%) 48.7% 51.3%
16S rRNA gene (size: 1592 bases) GC AT G C A T
Base content (bases) 688 904 414 274 336 568
Base content per 1 kb (bases) 432 568 260 172 211 357
Base content (%) 43.2% 56.8%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 298 386 246 52 164 222
Base content per 1 kb (bases) 436 564 360 76 240 325
Base content (%) 43.6% 56.4%
ATP8 (size: 169 bases) GC AT G C A T
Base content (bases) 69 100 59 10 40 60
Base content per 1 kb (bases) 408 592 349 59 237 355
Base content (%) 40.8% 59.2%
COX1 (size: 1558 bases) GC AT G C A T
Base content (bases) 693 865 461 232 410 455
Base content per 1 kb (bases) 445 555 296 149 263 292
Base content (%) 44.5% 55.5%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 293 395 215 78 172 223
Base content per 1 kb (bases) 426 574 313 113 250 324
Base content (%) 42.6% 57.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 369 415 259 110 196 219
Base content per 1 kb (bases) 471 529 330 140 250 279
Base content (%) 47.1% 52.9%
CYTB (size: 1150 bases) GC AT G C A T
Base content (bases) 519 631 393 126 290 341
Base content per 1 kb (bases) 451 549 342 110 252 297
Base content (%) 45.1% 54.9%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 420 546 300 120 254 292
Base content per 1 kb (bases) 435 565 311 124 263 302
Base content (%) 43.5% 56.5%
ND2 (size: 1059 bases) GC AT G C A T
Base content (bases) 454 605 341 113 283 322
Base content per 1 kb (bases) 429 571 322 107 267 304
Base content (%) 42.9% 57.1%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 151 197 112 39 95 102
Base content per 1 kb (bases) 434 566 322 112 273 293
Base content (%) 43.4% 56.6%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 644 730 485 159 307 423
Base content per 1 kb (bases) 469 531 353 116 223 308
Base content (%) 46.9% 53.1%
ND4L (size: 294 bases) GC AT G C A T
Base content (bases) 135 159 108 27 77 82
Base content per 1 kb (bases) 459 541 367 92 262 279
Base content (%) 45.9% 54.1%
ND5 (size: 1797 bases) GC AT G C A T
Base content (bases) 771 1026 602 169 426 600
Base content per 1 kb (bases) 429 571 335 94 237 334
Base content (%) 42.9% 57.1%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 240 282 206 34 58 224
Base content per 1 kb (bases) 460 540 395 65 111 429
Base content (%) 46.0% 54.0%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 28 (12.33%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 57 (25.11%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 19 (8.37%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 12 (5.29%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 3 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 13 13 4 19 27 0 7 9 0 3 1 3 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 8 4 0 0 2 5 0 3 7 9 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 13 0 5 4 1 0 0 2 1 3 2 0 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 1 0 1 4 0 0 0 3 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
32 85 79 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 70 39 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 91 104 29
ATP8 (size: 169 bases)
Amino acid sequence: MPQLNPEPWLVILLITWTFFTTILQPQTTSLIPTNDPLHMTYKPPKTWPWPWTLTY
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 11 (20.0%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 1 1 1 5 0 1 3 0 1 0 0 0 2 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 5 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 1 0 0 1 0 0 0 1 1 0 0 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 1 2 0 0 0 0 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 21 21 11
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 22 12 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 16 27 11
COX1 (size: 1558 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.49%)
Alanine (Ala, A)
n = 37 (7.14%)
Serine (Ser, S)
n = 29 (5.6%)
Threonine (Thr, T)
n = 44 (8.49%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 33 (6.37%)
Leucine (Leu, L)
n = 55 (10.62%)
Isoleucine (Ile, I)
n = 44 (8.49%)
Methionine (Met, M)
n = 32 (6.18%)
Proline (Pro, P)
n = 33 (6.37%)
Phenylalanine (Phe, F)
n = 45 (8.69%)
Tyrosine (Tyr, Y)
n = 19 (3.67%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 17 (3.28%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 17 (3.28%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 28 27 7 14 23 2 8 8 1 9 7 16 1 15 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 9 17 9 2 2 7 32 3 5 10 17 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 21 0 7 10 7 0 0 5 4 15 1 1 2 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 9 0 0 15 9 0 0 2 7 0 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
138 114 151 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 138 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 209 209 84
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 9 (3.95%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 23 (10.09%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 11 (4.82%)
Leucine (Leu, L)
n = 31 (13.6%)
Isoleucine (Ile, I)
n = 17 (7.46%)
Methionine (Met, M)
n = 15 (6.58%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 10 (4.39%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 12 (5.26%)
Asparagine (Asn, N)
n = 10 (4.39%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 9 (3.95%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 8 14 4 10 14 0 3 7 0 2 4 4 1 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 2 2 5 0 1 3 4 0 3 3 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 8 0 6 4 6 0 0 2 3 7 0 0 2 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 2 3 7 3 0 0 5 1 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 64 70 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 62 61 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 89 92 44
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 17 (6.54%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 27 (10.38%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 8 4 7 18 0 3 7 0 3 3 9 0 3 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 3 11 3 0 0 7 10 1 1 7 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 1 3 3 5 0 0 5 3 9 2 0 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 1 2 2 2 0 0 2 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 72 65 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 118 100 36
CYTB (size: 1150 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.28%)
Alanine (Ala, A)
n = 25 (6.54%)
Serine (Ser, S)
n = 27 (7.07%)
Threonine (Thr, T)
n = 31 (8.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (3.66%)
Leucine (Leu, L)
n = 66 (17.28%)
Isoleucine (Ile, I)
n = 33 (8.64%)
Methionine (Met, M)
n = 15 (3.93%)
Proline (Pro, P)
n = 27 (7.07%)
Phenylalanine (Phe, F)
n = 29 (7.59%)
Tyrosine (Tyr, Y)
n = 13 (3.4%)
Tryptophan (Trp, W)
n = 12 (3.14%)
Aspartic acid (Asp, D)
n = 6 (1.57%)
Glutamic acid (Glu, E)
n = 6 (1.57%)
Asparagine (Asn, N)
n = 17 (4.45%)
Glutamine (Gln, Q)
n = 7 (1.83%)
Histidine (His, H)
n = 13 (3.4%)
Lysine (Lys, K)
n = 10 (2.62%)
Arginine (Arg, R)
n = 8 (2.09%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 27 14 7 17 34 2 6 7 0 1 5 8 0 9 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 6 13 6 0 1 5 18 0 3 8 16 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 10 0 2 12 11 0 0 2 3 10 0 0 4 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 2 4 9 1 0 3 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 115 108 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 108 72 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 170 161 47
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.67%)
Alanine (Ala, A)
n = 27 (8.41%)
Serine (Ser, S)
n = 25 (7.79%)
Threonine (Thr, T)
n = 30 (9.35%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 10 (3.12%)
Leucine (Leu, L)
n = 57 (17.76%)
Isoleucine (Ile, I)
n = 24 (7.48%)
Methionine (Met, M)
n = 22 (6.85%)
Proline (Pro, P)
n = 24 (7.48%)
Phenylalanine (Phe, F)
n = 23 (7.17%)
Tyrosine (Tyr, Y)
n = 9 (2.8%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.43%)
Asparagine (Asn, N)
n = 10 (3.12%)
Glutamine (Gln, Q)
n = 7 (2.18%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 6 (1.87%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 10 19 3 11 34 3 6 7 0 3 2 5 0 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 12 9 1 0 8 3 4 6 4 14 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 13 1 4 6 9 0 0 6 3 6 2 0 2 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 0 3 6 0 1 1 5 0 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 91 98 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 100 49 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 109 145 51
ND2 (size: 1059 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.84%)
Alanine (Ala, A)
n = 34 (9.66%)
Serine (Ser, S)
n = 37 (10.51%)
Threonine (Thr, T)
n = 38 (10.8%)
Cysteine (Cys, C)
n = 1 (0.28%)
Valine (Val, V)
n = 16 (4.55%)
Leucine (Leu, L)
n = 60 (17.05%)
Isoleucine (Ile, I)
n = 31 (8.81%)
Methionine (Met, M)
n = 18 (5.11%)
Proline (Pro, P)
n = 18 (5.11%)
Phenylalanine (Phe, F)
n = 18 (5.11%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.84%)
Aspartic acid (Asp, D)
n = 2 (0.57%)
Glutamic acid (Glu, E)
n = 6 (1.7%)
Asparagine (Asn, N)
n = 11 (3.13%)
Glutamine (Gln, Q)
n = 9 (2.56%)
Histidine (His, H)
n = 4 (1.14%)
Lysine (Lys, K)
n = 15 (4.26%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 18 15 5 18 23 3 11 9 0 3 4 7 2 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 2 19 12 1 1 3 3 3 1 6 9 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 1 8 18 8 0 0 3 4 5 0 0 3 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 1 2 0 15 0 0 1 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 85 116 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 124 57 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 132 149 56
ND3 (size: 1059 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.84%)
Alanine (Ala, A)
n = 34 (9.66%)
Serine (Ser, S)
n = 37 (10.51%)
Threonine (Thr, T)
n = 38 (10.8%)
Cysteine (Cys, C)
n = 1 (0.28%)
Valine (Val, V)
n = 16 (4.55%)
Leucine (Leu, L)
n = 60 (17.05%)
Isoleucine (Ile, I)
n = 31 (8.81%)
Methionine (Met, M)
n = 18 (5.11%)
Proline (Pro, P)
n = 18 (5.11%)
Phenylalanine (Phe, F)
n = 18 (5.11%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.84%)
Aspartic acid (Asp, D)
n = 2 (0.57%)
Glutamic acid (Glu, E)
n = 6 (1.7%)
Asparagine (Asn, N)
n = 11 (3.13%)
Glutamine (Gln, Q)
n = 9 (2.56%)
Histidine (His, H)
n = 4 (1.14%)
Lysine (Lys, K)
n = 15 (4.26%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 18 15 5 18 23 3 11 9 0 3 4 7 2 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 2 19 12 1 1 3 3 3 1 6 9 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 1 8 18 8 0 0 3 4 5 0 0 3 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 1 2 0 15 0 0 1 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 85 116 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 124 57 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 132 149 56
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.6%)
Alanine (Ala, A)
n = 41 (8.97%)
Serine (Ser, S)
n = 40 (8.75%)
Threonine (Thr, T)
n = 60 (13.13%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 12 (2.63%)
Leucine (Leu, L)
n = 86 (18.82%)
Isoleucine (Ile, I)
n = 29 (6.35%)
Methionine (Met, M)
n = 24 (5.25%)
Proline (Pro, P)
n = 28 (6.13%)
Phenylalanine (Phe, F)
n = 17 (3.72%)
Tyrosine (Tyr, Y)
n = 11 (2.41%)
Tryptophan (Trp, W)
n = 10 (2.19%)
Aspartic acid (Asp, D)
n = 8 (1.75%)
Glutamic acid (Glu, E)
n = 6 (1.31%)
Asparagine (Asn, N)
n = 17 (3.72%)
Glutamine (Gln, Q)
n = 15 (3.28%)
Histidine (His, H)
n = 6 (1.31%)
Lysine (Lys, K)
n = 11 (2.41%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 23 22 12 21 41 1 11 15 0 0 4 7 1 4 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 4 5 24 12 0 2 10 6 3 2 10 15 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 24 2 1 15 14 2 0 8 4 7 2 0 3 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 0 8 9 2 0 0 8 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 133 149 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 161 75 168
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 191 199 51
ND4L (size: 294 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.12%)
Alanine (Ala, A)
n = 6 (6.19%)
Serine (Ser, S)
n = 7 (7.22%)
Threonine (Thr, T)
n = 14 (14.43%)
Cysteine (Cys, C)
n = 3 (3.09%)
Valine (Val, V)
n = 5 (5.15%)
Leucine (Leu, L)
n = 25 (25.77%)
Isoleucine (Ile, I)
n = 7 (7.22%)
Methionine (Met, M)
n = 2 (2.06%)
Proline (Pro, P)
n = 3 (3.09%)
Phenylalanine (Phe, F)
n = 4 (4.12%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.06%)
Asparagine (Asn, N)
n = 5 (5.15%)
Glutamine (Gln, Q)
n = 1 (1.03%)
Histidine (His, H)
n = 6 (6.19%)
Lysine (Lys, K)
n = 1 (1.03%)
Arginine (Arg, R)
n = 2 (2.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 2 6 8 5 0 6 1 0 0 3 2 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 2 2 3 1 0 0 3 1 0 0 2 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 1 0 2 5 0 0 0 0 0 0 0 0 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 0 0 0 1 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 31 29 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 30 16 43
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 47 37 13
ND5 (size: 1797 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (3.51%)
Alanine (Ala, A)
n = 48 (8.03%)
Serine (Ser, S)
n = 49 (8.19%)
Threonine (Thr, T)
n = 78 (13.04%)
Cysteine (Cys, C)
n = 4 (0.67%)
Valine (Val, V)
n = 9 (1.51%)
Leucine (Leu, L)
n = 95 (15.89%)
Isoleucine (Ile, I)
n = 54 (9.03%)
Methionine (Met, M)
n = 29 (4.85%)
Proline (Pro, P)
n = 35 (5.85%)
Phenylalanine (Phe, F)
n = 37 (6.19%)
Tyrosine (Tyr, Y)
n = 15 (2.51%)
Tryptophan (Trp, W)
n = 10 (1.67%)
Aspartic acid (Asp, D)
n = 10 (1.67%)
Glutamic acid (Glu, E)
n = 12 (2.01%)
Asparagine (Asn, N)
n = 29 (4.85%)
Glutamine (Gln, Q)
n = 13 (2.17%)
Histidine (His, H)
n = 15 (2.51%)
Lysine (Lys, K)
n = 27 (4.52%)
Arginine (Arg, R)
n = 8 (1.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 33 28 8 19 50 4 12 13 0 1 4 4 0 11 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 2 6 28 14 0 1 5 14 1 4 12 18 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
36 29 2 6 15 17 1 1 9 1 14 2 2 5 24 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 12 0 1 9 27 0 2 1 5 0 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 152 228 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 200 121 224
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 250 251 83
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.18%)
Alanine (Ala, A)
n = 9 (5.2%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 10 (5.78%)
Valine (Val, V)
n = 36 (20.81%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 2 (1.16%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 2 (1.16%)
Tryptophan (Trp, W)
n = 3 (1.73%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 0 1 0 0 1 4 0 0 15 2 3 16 13 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 10 0 5 0 2 2 9 0 3 16 1 0 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 2 1 1 1 7 0 1 1 3 20 2 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 3 3 0 0 1 2 0 1 0 1 0 0 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 9 25 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 19 15 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
73 6 18 77
Total protein-coding genes (size: 11393 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 205 (5.4%)
Alanine (Ala, A)
n = 272 (7.17%)
Serine (Ser, S)
n = 279 (7.35%)
Threonine (Thr, T)
n = 400 (10.54%)
Cysteine (Cys, C)
n = 34 (0.9%)
Valine (Val, V)
n = 172 (4.53%)
Leucine (Leu, L)
n = 624 (16.44%)
Isoleucine (Ile, I)
n = 293 (7.72%)
Methionine (Met, M)
n = 196 (5.16%)
Proline (Pro, P)
n = 233 (6.14%)
Phenylalanine (Phe, F)
n = 233 (6.14%)
Tyrosine (Tyr, Y)
n = 108 (2.85%)
Tryptophan (Trp, W)
n = 99 (2.61%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 87 (2.29%)
Asparagine (Asn, N)
n = 140 (3.69%)
Glutamine (Gln, Q)
n = 89 (2.35%)
Histidine (His, H)
n = 97 (2.56%)
Lysine (Lys, K)
n = 94 (2.48%)
Arginine (Arg, R)
n = 67 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
109 184 168 67 154 285 16 79 88 1 41 41 69 21 82 151
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
28 17 17 47 140 79 6 18 55 101 31 30 77 119 7 48
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
179 163 10 46 92 86 4 9 42 30 78 15 23 29 111 14
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
83 75 12 13 53 90 4 5 17 44 1 1 1 5 1 84
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
802 1008 1176 810
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
458 1133 687 1518
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
181 1474 1536 605

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.