Viewing data for Calyptorhynchus baudinii


Scientific name Calyptorhynchus baudinii
Common name Long-billed black cockatoo
Maximum lifespan 47.00 years (Calyptorhynchus baudinii@AnAge)

Total mtDNA (size: 16841 bases) GC AT G C A T
Base content (bases) 7462 9280 5180 2282 4045 5235
Base content per 1 kb (bases) 443 551 308 136 240 311
Base content (%) 44.3% 55.1%
Total protein-coding genes (size: 11384 bases) GC AT G C A T
Base content (bases) 5091 6282 3734 1357 2770 3512
Base content per 1 kb (bases) 447 552 328 119 243 309
Base content (%) 44.7% 55.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1547 bases) GC AT G C A T
Base content (bases) 639 898 385 254 376 522
Base content per 1 kb (bases) 413 580 249 164 243 337
Base content (%) 41.3% 58.0%
Total rRNA-coding genes (size: 2577 bases) GC AT G C A T
Base content (bases) 1223 1315 752 471 461 854
Base content per 1 kb (bases) 475 510 292 183 179 331
Base content (%) 47.5% 51.0%
12S rRNA gene (size: 981 bases) GC AT G C A T
Base content (bases) 481 486 298 183 171 315
Base content per 1 kb (bases) 490 495 304 187 174 321
Base content (%) 49.0% 49.5%
16S rRNA gene (size: 1596 bases) GC AT G C A T
Base content (bases) 742 829 454 288 290 539
Base content per 1 kb (bases) 465 519 284 180 182 338
Base content (%) 46.5% 51.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 302 382 244 58 176 206
Base content per 1 kb (bases) 442 558 357 85 257 301
Base content (%) 44.2% 55.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 61 9 35 63
Base content per 1 kb (bases) 417 583 363 54 208 375
Base content (%) 41.7% 58.3%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 715 833 464 251 395 438
Base content per 1 kb (bases) 462 538 300 162 255 283
Base content (%) 46.2% 53.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 294 390 202 92 173 217
Base content per 1 kb (bases) 430 570 295 135 253 317
Base content (%) 43.0% 57.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 368 416 249 119 194 222
Base content per 1 kb (bases) 469 531 318 152 247 283
Base content (%) 46.9% 53.1%
CYTB (size: 1138 bases) GC AT G C A T
Base content (bases) 507 631 370 137 299 332
Base content per 1 kb (bases) 446 554 325 120 263 292
Base content (%) 44.6% 55.4%
ND1 (size: 981 bases) GC AT G C A T
Base content (bases) 450 531 333 117 246 285
Base content per 1 kb (bases) 459 541 339 119 251 291
Base content (%) 45.9% 54.1%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 467 573 378 89 234 339
Base content per 1 kb (bases) 449 551 363 86 225 326
Base content (%) 44.9% 55.1%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 155 196 111 44 92 104
Base content per 1 kb (bases) 442 558 316 125 262 296
Base content (%) 44.2% 55.8%
ND4 (size: 1393 bases) GC AT G C A T
Base content (bases) 624 767 489 135 344 423
Base content per 1 kb (bases) 448 551 351 97 247 304
Base content (%) 44.8% 55.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 129 168 95 34 84 84
Base content per 1 kb (bases) 434 566 320 114 283 283
Base content (%) 43.4% 56.6%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 776 1030 567 209 435 595
Base content per 1 kb (bases) 428 567 312 115 240 328
Base content (%) 42.8% 56.7%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 239 280 174 65 68 212
Base content per 1 kb (bases) 461 539 335 125 131 408
Base content (%) 46.1% 53.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 31 (13.66%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 60 (26.43%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 16 11 12 18 20 2 8 7 1 0 3 4 0 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 8 3 0 1 3 4 0 2 7 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 13 0 0 3 5 0 1 2 1 3 1 0 5 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 3 0 1 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
33 86 77 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 69 33 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 89 96 38
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWLFIMITSWLTFTLIIQPKVLSFTPTNPPTNKTPMITKTNPWNWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 6 (10.91%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 2 0 2 3 0 0 1 1 0 0 1 0 0 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 5 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 0 1 2 0 0 0 0 0 0 0 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 17 26 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 22 12 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 22 25 6
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 46 (8.93%)
Serine (Ser, S)
n = 26 (5.05%)
Threonine (Thr, T)
n = 40 (7.77%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 33 (6.41%)
Leucine (Leu, L)
n = 64 (12.43%)
Isoleucine (Ile, I)
n = 43 (8.35%)
Methionine (Met, M)
n = 23 (4.47%)
Proline (Pro, P)
n = 31 (6.02%)
Phenylalanine (Phe, F)
n = 41 (7.96%)
Tyrosine (Tyr, Y)
n = 17 (3.3%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 11 (2.14%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.69%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 25 19 6 13 30 6 9 9 1 1 10 19 3 13 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 9 19 18 0 8 11 25 3 6 10 15 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 15 2 2 10 11 0 0 3 6 11 1 0 3 12 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 11 0 0 14 8 1 1 2 4 1 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 123 134 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 140 95 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 201 209 83
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 14 6 1 11 14 3 4 7 1 6 2 3 0 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 2 7 4 0 1 1 6 0 3 1 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 0 2 6 10 0 0 3 3 5 0 0 0 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 13 2 5 7 4 0 0 3 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 62 59 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 60 60 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 80 98 41
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 10 (3.85%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 17 5 2 9 17 1 3 9 1 2 5 6 0 4 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 4 6 9 1 1 5 13 1 5 2 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 9 1 2 4 8 0 0 6 2 7 2 2 0 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 3 1 3 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 71 60 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 69 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 109 108 33
CYTB (size: 1138 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.08%)
Alanine (Ala, A)
n = 26 (6.88%)
Serine (Ser, S)
n = 27 (7.14%)
Threonine (Thr, T)
n = 30 (7.94%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 15 (3.97%)
Leucine (Leu, L)
n = 65 (17.2%)
Isoleucine (Ile, I)
n = 31 (8.2%)
Methionine (Met, M)
n = 9 (2.38%)
Proline (Pro, P)
n = 25 (6.61%)
Phenylalanine (Phe, F)
n = 27 (7.14%)
Tyrosine (Tyr, Y)
n = 13 (3.44%)
Tryptophan (Trp, W)
n = 11 (2.91%)
Aspartic acid (Asp, D)
n = 6 (1.59%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 22 (5.82%)
Glutamine (Gln, Q)
n = 8 (2.12%)
Histidine (His, H)
n = 13 (3.44%)
Lysine (Lys, K)
n = 10 (2.65%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 20 8 6 13 38 0 8 6 2 3 2 9 1 8 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 2 7 13 6 0 1 5 15 2 4 9 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 11 0 2 12 11 0 0 2 6 7 1 0 3 19 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 2 0 6 7 3 0 3 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 110 104 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 106 79 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 154 149 63
ND1 (size: 981 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.68%)
Alanine (Ala, A)
n = 28 (8.59%)
Serine (Ser, S)
n = 30 (9.2%)
Threonine (Thr, T)
n = 24 (7.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.76%)
Leucine (Leu, L)
n = 67 (20.55%)
Isoleucine (Ile, I)
n = 22 (6.75%)
Methionine (Met, M)
n = 18 (5.52%)
Proline (Pro, P)
n = 27 (8.28%)
Phenylalanine (Phe, F)
n = 16 (4.91%)
Tyrosine (Tyr, Y)
n = 15 (4.6%)
Tryptophan (Trp, W)
n = 9 (2.76%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.37%)
Asparagine (Asn, N)
n = 12 (3.68%)
Glutamine (Gln, Q)
n = 5 (1.53%)
Histidine (His, H)
n = 2 (0.61%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 15 15 7 20 31 1 7 4 1 1 5 2 1 3 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 11 13 1 1 6 3 2 6 9 12 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 14 0 5 9 9 0 3 4 4 11 1 1 0 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 1 3 6 1 0 2 6 0 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 101 91 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 102 56 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 130 138 43
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 20 (5.8%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 54 (15.65%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 70 (20.29%)
Isoleucine (Ile, I)
n = 28 (8.12%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 15 (4.35%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 21 16 7 23 36 2 2 8 1 0 4 3 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 6 10 0 2 4 3 3 1 10 11 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 19 0 2 12 15 1 0 5 0 6 1 0 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 1 13 2 0 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 108 132 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 126 54 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 144 152 38
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 20 (5.8%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 54 (15.65%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 70 (20.29%)
Isoleucine (Ile, I)
n = 28 (8.12%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 15 (4.35%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 21 16 7 23 36 2 2 8 1 0 4 3 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 6 10 0 2 4 3 3 1 10 11 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 19 0 2 12 15 1 0 5 0 6 1 0 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 1 13 2 0 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 108 132 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 126 54 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 144 152 38
ND4 (size: 1393 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.67%)
Alanine (Ala, A)
n = 33 (7.13%)
Serine (Ser, S)
n = 37 (7.99%)
Threonine (Thr, T)
n = 56 (12.1%)
Cysteine (Cys, C)
n = 5 (1.08%)
Valine (Val, V)
n = 7 (1.51%)
Leucine (Leu, L)
n = 102 (22.03%)
Isoleucine (Ile, I)
n = 30 (6.48%)
Methionine (Met, M)
n = 26 (5.62%)
Proline (Pro, P)
n = 35 (7.56%)
Phenylalanine (Phe, F)
n = 15 (3.24%)
Tyrosine (Tyr, Y)
n = 12 (2.59%)
Tryptophan (Trp, W)
n = 12 (2.59%)
Aspartic acid (Asp, D)
n = 2 (0.43%)
Glutamic acid (Glu, E)
n = 9 (1.94%)
Asparagine (Asn, N)
n = 15 (3.24%)
Glutamine (Gln, Q)
n = 14 (3.02%)
Histidine (His, H)
n = 16 (3.46%)
Lysine (Lys, K)
n = 10 (2.16%)
Arginine (Arg, R)
n = 10 (2.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 21 24 16 20 50 4 11 13 1 4 0 3 0 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 4 5 16 11 1 4 5 6 2 7 15 13 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 23 1 3 15 9 1 2 7 4 8 1 1 3 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 0 2 10 0 1 4 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 165 146 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 152 78 180
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 172 198 79
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.06%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 6 3 3 10 0 4 3 0 0 0 2 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 2 6 2 0 0 1 2 0 0 2 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 0 3 5 2 0 0 3 0 3 0 0 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 1 0 0 0 0 0 1 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 29 23 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 30 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 36 43 18
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.3%)
Alanine (Ala, A)
n = 51 (8.44%)
Serine (Ser, S)
n = 46 (7.62%)
Threonine (Thr, T)
n = 73 (12.09%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 10 (1.66%)
Leucine (Leu, L)
n = 104 (17.22%)
Isoleucine (Ile, I)
n = 45 (7.45%)
Methionine (Met, M)
n = 33 (5.46%)
Proline (Pro, P)
n = 28 (4.64%)
Phenylalanine (Phe, F)
n = 36 (5.96%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 11 (1.82%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 30 (4.97%)
Glutamine (Gln, Q)
n = 20 (3.31%)
Histidine (His, H)
n = 12 (1.99%)
Lysine (Lys, K)
n = 23 (3.81%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 31 30 12 18 57 7 10 18 2 0 2 6 2 13 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 3 13 22 16 0 2 8 19 3 1 9 17 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 31 6 7 16 12 0 3 8 3 10 1 0 4 26 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 0 2 6 18 5 3 2 3 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
112 162 215 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 187 118 228
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 217 259 94
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.95%)
Alanine (Ala, A)
n = 14 (8.14%)
Serine (Ser, S)
n = 14 (8.14%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 32 (18.6%)
Leucine (Leu, L)
n = 26 (15.12%)
Isoleucine (Ile, I)
n = 6 (3.49%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 5 (2.91%)
Phenylalanine (Phe, F)
n = 13 (7.56%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 6 (3.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 2 3 1 1 4 7 0 1 13 2 5 12 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 7 2 3 2 5 0 6 13 2 1 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 7 2 0 1 4 0 4 3 2 10 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 4 0 0 1 2 0 1 3 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 21 22 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 31 18 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 13 28 74
Total protein-coding genes (size: 11401 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 211 (5.56%)
Alanine (Ala, A)
n = 282 (7.43%)
Serine (Ser, S)
n = 287 (7.56%)
Threonine (Thr, T)
n = 376 (9.9%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 150 (3.95%)
Leucine (Leu, L)
n = 677 (17.83%)
Isoleucine (Ile, I)
n = 282 (7.43%)
Methionine (Met, M)
n = 176 (4.64%)
Proline (Pro, P)
n = 236 (6.22%)
Phenylalanine (Phe, F)
n = 216 (5.69%)
Tyrosine (Tyr, Y)
n = 110 (2.9%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 60 (1.58%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 137 (3.61%)
Glutamine (Gln, Q)
n = 101 (2.66%)
Histidine (His, H)
n = 99 (2.61%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
92 190 149 76 158 323 30 76 87 14 30 36 65 19 69 147
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
27 11 17 61 119 97 5 26 50 105 30 40 82 111 3 57
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
152 156 11 37 96 94 3 13 44 33 77 12 14 26 111 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
69 81 11 16 44 76 14 8 19 36 5 0 2 5 1 94
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
795 1091 1120 786
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
472 1124 695 1501
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
201 1411 1555 625

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.