Viewing data for Aegypius monachus


Scientific name Aegypius monachus
Common name Eurasian black vulture
Maximum lifespan 39.00 years (Aegypius monachus@AnAge)

Total mtDNA (size: 17811 bases) GC AT G C A T
Base content (bases) 8187 9624 5656 2531 4341 5283
Base content per 1 kb (bases) 460 540 318 142 244 297
Base content (%) 46.0% 54.0%
Total protein-coding genes (size: 11380 bases) GC AT G C A T
Base content (bases) 5416 5964 3980 1436 2658 3306
Base content per 1 kb (bases) 476 524 350 126 234 291
Base content (%) 47.6% 52.4%
D-loop (size: 2250 bases) GC AT G C A T
Base content (bases) 868 1382 529 339 756 626
Base content per 1 kb (bases) 386 614 235 151 336 278
Base content (%) 38.6% 61.4%
Total tRNA-coding genes (size: 1551 bases) GC AT G C A T
Base content (bases) 671 880 405 266 379 501
Base content per 1 kb (bases) 433 567 261 172 244 323
Base content (%) 43.3% 56.7%
Total rRNA-coding genes (size: 2609 bases) GC AT G C A T
Base content (bases) 1230 1379 723 507 533 846
Base content per 1 kb (bases) 471 529 277 194 204 324
Base content (%) 47.1% 52.9%
12S rRNA gene (size: 981 bases) GC AT G C A T
Base content (bases) 480 501 280 200 200 301
Base content per 1 kb (bases) 489 511 285 204 204 307
Base content (%) 48.9% 51.1%
16S rRNA gene (size: 1628 bases) GC AT G C A T
Base content (bases) 750 878 443 307 333 545
Base content per 1 kb (bases) 461 539 272 189 205 335
Base content (%) 46.1% 53.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 321 363 253 68 163 200
Base content per 1 kb (bases) 469 531 370 99 238 292
Base content (%) 46.9% 53.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 82 86 70 12 34 52
Base content per 1 kb (bases) 488 512 417 71 202 310
Base content (%) 48.8% 51.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 750 801 491 259 379 422
Base content per 1 kb (bases) 484 516 317 167 244 272
Base content (%) 48.4% 51.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 323 361 222 101 151 210
Base content per 1 kb (bases) 472 528 325 148 221 307
Base content (%) 47.2% 52.8%
COX3 (size: 783 bases) GC AT G C A T
Base content (bases) 376 407 257 119 199 208
Base content per 1 kb (bases) 480 520 328 152 254 266
Base content (%) 48.0% 52.0%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 558 585 406 152 271 314
Base content per 1 kb (bases) 488 512 355 133 237 275
Base content (%) 48.8% 51.2%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 463 515 328 135 256 259
Base content per 1 kb (bases) 473 527 335 138 262 265
Base content (%) 47.3% 52.7%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 475 570 368 107 244 326
Base content per 1 kb (bases) 455 545 352 102 233 312
Base content (%) 45.5% 54.5%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 163 188 123 40 91 97
Base content per 1 kb (bases) 464 536 350 114 259 276
Base content (%) 46.4% 53.6%
ND4 (size: 1377 bases) GC AT G C A T
Base content (bases) 669 708 523 146 315 393
Base content per 1 kb (bases) 486 514 380 106 229 285
Base content (%) 48.6% 51.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 135 162 99 36 82 80
Base content per 1 kb (bases) 455 545 333 121 276 269
Base content (%) 45.5% 54.5%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 849 969 640 209 411 558
Base content per 1 kb (bases) 467 533 352 115 226 307
Base content (%) 46.7% 53.3%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 257 262 203 54 66 196
Base content per 1 kb (bases) 495 505 391 104 127 378
Base content (%) 49.5% 50.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 28 (12.33%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 63 (27.75%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 15 7 5 12 38 4 4 8 0 1 5 2 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 9 4 0 2 2 4 0 5 7 5 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 9 2 2 2 3 0 1 4 1 2 1 0 0 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 3 0 0 3 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 93 71 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 67 32 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 93 97 29
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWLYIMLASWLILTLVIQPKLLPFTPTNSPSNKPTTTTSTLSWNWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 1 (1.82%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 1 1 4 3 0 1 2 0 0 1 0 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 1 0 0 0 0 0 0 0 4 4 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 0 3 0 1 0 1 0 1 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 19 21 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 24 10 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 27 21 5
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 41 (7.95%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.36%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 37 (7.17%)
Methionine (Met, M)
n = 26 (5.04%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 28 23 6 13 31 1 10 7 2 2 19 16 1 9 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 11 25 10 0 6 18 18 5 4 6 20 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 4 3 9 10 2 0 3 2 15 2 1 2 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 3 2 13 9 0 0 2 6 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
156 118 132 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 142 94 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 231 196 64
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 14 (6.17%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 15 10 6 6 13 3 1 6 1 2 7 6 0 0 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 2 9 5 0 0 3 3 2 1 3 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 1 1 9 7 0 1 1 2 6 0 0 1 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 12 2 3 9 4 0 1 2 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 63 57 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 60 61 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 99 92 25
COX3 (size: 783 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 18 (6.92%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 8 7 5 10 16 1 2 7 1 0 5 8 0 3 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 3 8 8 2 5 7 8 0 2 8 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 0 1 7 5 1 1 5 2 8 1 0 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 1 2 2 2 0 1 0 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 74 57 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 54 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 117 97 38
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 20 (5.26%)
Serine (Ser, S)
n = 30 (7.89%)
Threonine (Thr, T)
n = 27 (7.11%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 13 (3.42%)
Leucine (Leu, L)
n = 61 (16.05%)
Isoleucine (Ile, I)
n = 26 (6.84%)
Methionine (Met, M)
n = 10 (2.63%)
Proline (Pro, P)
n = 33 (8.68%)
Phenylalanine (Phe, F)
n = 24 (6.32%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 10 (2.63%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 24 (6.32%)
Glutamine (Gln, Q)
n = 7 (1.84%)
Histidine (His, H)
n = 19 (5.0%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 13 (3.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 18 7 8 11 34 5 3 5 2 0 6 7 0 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 2 11 7 0 0 10 8 5 5 13 13 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 8 1 3 14 7 0 3 3 6 8 4 0 4 20 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 4 2 1 5 9 1 0 5 5 3 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 130 103 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 104 87 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 172 124 57
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 33 (10.15%)
Serine (Ser, S)
n = 27 (8.31%)
Threonine (Thr, T)
n = 21 (6.46%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 14 (4.31%)
Leucine (Leu, L)
n = 65 (20.0%)
Isoleucine (Ile, I)
n = 21 (6.46%)
Methionine (Met, M)
n = 14 (4.31%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 13 (4.0%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 10 (3.08%)
Asparagine (Asn, N)
n = 11 (3.38%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 13 9 5 20 29 3 8 4 2 1 3 8 2 4 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 8 15 10 0 2 2 5 4 7 8 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 3 11 8 0 1 4 7 6 3 0 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 1 1 3 7 0 0 4 2 2 0 1 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 100 80 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 100 56 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 128 123 52
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.46%)
Alanine (Ala, A)
n = 35 (10.09%)
Serine (Ser, S)
n = 31 (8.93%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 26 (7.49%)
Methionine (Met, M)
n = 16 (4.61%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 10 (2.88%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 20 13 7 17 38 0 6 6 3 1 3 3 2 3 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 19 12 0 1 3 8 0 4 8 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 23 2 3 14 10 1 1 2 2 4 2 1 1 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 1 0 12 1 0 1 1 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 103 118 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 129 57 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 136 151 44
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.46%)
Alanine (Ala, A)
n = 35 (10.09%)
Serine (Ser, S)
n = 31 (8.93%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 26 (7.49%)
Methionine (Met, M)
n = 16 (4.61%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 10 (2.88%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 20 13 7 17 38 0 6 6 3 1 3 3 2 3 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 19 12 0 1 3 8 0 4 8 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 23 2 3 14 10 1 1 2 2 4 2 1 1 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 1 0 12 1 0 1 1 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 103 118 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 129 57 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 136 151 44
ND4 (size: 1377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.28%)
Alanine (Ala, A)
n = 23 (5.02%)
Serine (Ser, S)
n = 49 (10.7%)
Threonine (Thr, T)
n = 47 (10.26%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 8 (1.75%)
Leucine (Leu, L)
n = 91 (19.87%)
Isoleucine (Ile, I)
n = 26 (5.68%)
Methionine (Met, M)
n = 15 (3.28%)
Proline (Pro, P)
n = 39 (8.52%)
Phenylalanine (Phe, F)
n = 14 (3.06%)
Tyrosine (Tyr, Y)
n = 23 (5.02%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 6 (1.31%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 6 (1.31%)
Glutamine (Gln, Q)
n = 24 (5.24%)
Histidine (His, H)
n = 22 (4.8%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 18 14 10 22 45 4 9 17 7 0 4 4 0 1 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 5 3 9 9 2 2 10 1 2 5 22 10 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 13 1 3 16 17 0 2 11 6 17 2 1 2 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 7 4 3 3 10 1 0 7 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 176 118 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 145 104 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 202 171 59
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 6 2 2 11 0 5 2 0 1 1 1 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 2 1 6 2 0 0 3 1 0 0 2 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 2 6 2 0 0 3 0 2 1 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 0 0 1 0 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 27 24 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 17 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 43 39 15
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.29%)
Alanine (Ala, A)
n = 51 (8.43%)
Serine (Ser, S)
n = 43 (7.11%)
Threonine (Thr, T)
n = 80 (13.22%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 11 (1.82%)
Leucine (Leu, L)
n = 107 (17.69%)
Isoleucine (Ile, I)
n = 50 (8.26%)
Methionine (Met, M)
n = 30 (4.96%)
Proline (Pro, P)
n = 32 (5.29%)
Phenylalanine (Phe, F)
n = 32 (5.29%)
Tyrosine (Tyr, Y)
n = 14 (2.31%)
Tryptophan (Trp, W)
n = 11 (1.82%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 14 (2.31%)
Asparagine (Asn, N)
n = 24 (3.97%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 19 (3.14%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 36 24 10 38 43 4 12 16 3 1 6 4 0 7 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 6 9 26 15 1 1 9 19 3 4 11 17 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
39 31 1 3 17 14 1 0 8 1 13 1 0 6 18 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 12 2 1 7 16 3 1 6 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
116 168 211 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 198 111 230
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 274 236 70
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.7%)
Alanine (Ala, A)
n = 15 (8.72%)
Serine (Ser, S)
n = 10 (5.81%)
Threonine (Thr, T)
n = 3 (1.74%)
Cysteine (Cys, C)
n = 5 (2.91%)
Valine (Val, V)
n = 33 (19.19%)
Leucine (Leu, L)
n = 25 (14.53%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 11 (6.4%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 6 (3.49%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 5 (2.91%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.91%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 1 3 0 0 4 4 0 0 14 1 7 11 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 2 6 1 2 6 4 1 5 17 1 0 1 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 3 1 1 2 3 0 6 1 3 14 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 3 4 0 0 1 1 0 1 3 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 16 18 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 29 19 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
73 9 29 62
Total protein-coding genes (size: 11398 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.63%)
Alanine (Ala, A)
n = 290 (7.64%)
Serine (Ser, S)
n = 299 (7.87%)
Threonine (Thr, T)
n = 357 (9.4%)
Cysteine (Cys, C)
n = 34 (0.9%)
Valine (Val, V)
n = 167 (4.4%)
Leucine (Leu, L)
n = 653 (17.19%)
Isoleucine (Ile, I)
n = 257 (6.77%)
Methionine (Met, M)
n = 161 (4.24%)
Proline (Pro, P)
n = 248 (6.53%)
Phenylalanine (Phe, F)
n = 206 (5.42%)
Tyrosine (Tyr, Y)
n = 122 (3.21%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 125 (3.29%)
Glutamine (Gln, Q)
n = 102 (2.69%)
Histidine (His, H)
n = 128 (3.37%)
Lysine (Lys, K)
n = 82 (2.16%)
Arginine (Arg, R)
n = 79 (2.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
76 181 123 71 160 308 30 67 81 21 23 62 66 16 46 160
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 9 25 52 143 84 11 23 71 80 40 43 94 103 8 56
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
156 133 12 27 113 87 8 14 50 37 85 20 17 23 102 29
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
99 75 19 18 46 75 7 4 31 35 9 0 2 8 2 85
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
829 1126 1048 796
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
498 1130 727 1444
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
260 1578 1410 551

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.