Viewing data for Cebus apella


Scientific name Cebus apella
Common name Brown capuchin
Maximum lifespan 46.00 years (Cebus apella@AnAge)

Total mtDNA (size: 16538 bases) GC AT G C A T
Base content (bases) 6514 10015 4383 2131 4595 5420
Base content per 1 kb (bases) 394 606 265 129 278 328
Base content (%) 39.4% 60.6%
Total protein-coding genes (size: 11350 bases) GC AT G C A T
Base content (bases) 4446 6903 3149 1297 3261 3642
Base content per 1 kb (bases) 392 608 277 114 287 321
Base content (%) 39.2% 60.8%
D-loop (size: 1096 bases) GC AT G C A T
Base content (bases) 475 620 295 180 295 325
Base content per 1 kb (bases) 433 566 269 164 269 297
Base content (%) 43.3% 56.6%
Total tRNA-coding genes (size: 1493 bases) GC AT G C A T
Base content (bases) 540 953 318 222 422 531
Base content per 1 kb (bases) 362 638 213 149 283 356
Base content (%) 36.2% 63.8%
Total rRNA-coding genes (size: 2523 bases) GC AT G C A T
Base content (bases) 1019 1497 593 426 598 899
Base content per 1 kb (bases) 404 593 235 169 237 356
Base content (%) 40.4% 59.3%
12S rRNA gene (size: 960 bases) GC AT G C A T
Base content (bases) 420 540 241 179 215 325
Base content per 1 kb (bases) 438 563 251 186 224 339
Base content (%) 43.8% 56.3%
16S rRNA gene (size: 1563 bases) GC AT G C A T
Base content (bases) 599 957 352 247 383 574
Base content per 1 kb (bases) 383 612 225 158 245 367
Base content (%) 38.3% 61.2%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 264 417 202 62 197 220
Base content per 1 kb (bases) 388 612 297 91 289 323
Base content (%) 38.8% 61.2%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 64 137 49 15 55 82
Base content per 1 kb (bases) 318 682 244 75 274 408
Base content (%) 31.8% 68.2%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 639 918 372 267 492 426
Base content per 1 kb (bases) 410 590 239 171 316 274
Base content (%) 41.0% 59.0%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 265 423 175 90 197 226
Base content per 1 kb (bases) 385 615 254 131 286 328
Base content (%) 38.5% 61.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 344 440 222 122 222 218
Base content per 1 kb (bases) 439 561 283 156 283 278
Base content (%) 43.9% 56.1%
CYTB (size: 1137 bases) GC AT G C A T
Base content (bases) 463 674 339 124 340 334
Base content per 1 kb (bases) 407 593 298 109 299 294
Base content (%) 40.7% 59.3%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 380 575 279 101 265 310
Base content per 1 kb (bases) 397 601 292 106 277 324
Base content (%) 39.7% 60.1%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 373 666 300 73 288 378
Base content per 1 kb (bases) 359 641 289 70 277 364
Base content (%) 35.9% 64.1%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 137 209 95 42 97 112
Base content per 1 kb (bases) 396 604 275 121 280 324
Base content (%) 39.6% 60.4%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 533 842 393 140 387 455
Base content per 1 kb (bases) 388 612 286 102 281 331
Base content (%) 38.8% 61.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 107 190 66 41 100 90
Base content per 1 kb (bases) 360 640 222 138 337 303
Base content (%) 36.0% 64.0%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 694 1112 513 181 522 590
Base content per 1 kb (bases) 384 616 284 100 289 327
Base content (%) 38.4% 61.6%
ND6 (size: 534 bases) GC AT G C A T
Base content (bases) 198 336 155 43 115 221
Base content per 1 kb (bases) 371 629 290 81 215 414
Base content (%) 37.1% 62.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 13 (5.75%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 26 (11.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 48 (21.24%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 16 (7.08%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 2 (0.88%)
Asparagine (Asn, N)
n = 15 (6.64%)
Glutamine (Gln, Q)
n = 10 (4.42%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 14 10 12 6 19 2 8 10 0 1 2 5 0 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 2 5 6 0 1 2 6 0 3 5 4 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 1 3 5 3 0 1 1 2 2 1 1 5 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 1 1 0 1 4 0 1 0 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
33 69 87 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 62 42 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 71 91 53
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDISPWPMVTLSMILTLFYAMQLKMLNFTFHTTTLSELTKMQNQKTTWELKWTKIYSPLSMCQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 5 (7.58%)
Threonine (Thr, T)
n = 10 (15.15%)
Cysteine (Cys, C)
n = 1 (1.52%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 10 (15.15%)
Isoleucine (Ile, I)
n = 3 (4.55%)
Methionine (Met, M)
n = 7 (10.61%)
Proline (Pro, P)
n = 4 (6.06%)
Phenylalanine (Phe, F)
n = 3 (4.55%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 5 (7.58%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 5 (7.58%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 5 1 0 7 0 2 3 2 0 0 0 1 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 0 0 0 0 0 0 0 2 0 2 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 0 4 1 0 0 2 0 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 5 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 18 27 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 20 19 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 11 36 14
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.88%)
Alanine (Ala, A)
n = 39 (7.53%)
Serine (Ser, S)
n = 29 (5.6%)
Threonine (Thr, T)
n = 36 (6.95%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.76%)
Leucine (Leu, L)
n = 65 (12.55%)
Isoleucine (Ile, I)
n = 40 (7.72%)
Methionine (Met, M)
n = 30 (5.79%)
Proline (Pro, P)
n = 28 (5.41%)
Phenylalanine (Phe, F)
n = 42 (8.11%)
Tyrosine (Tyr, Y)
n = 21 (4.05%)
Tryptophan (Trp, W)
n = 16 (3.09%)
Aspartic acid (Asp, D)
n = 16 (3.09%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 19 (3.67%)
Glutamine (Gln, Q)
n = 8 (1.54%)
Histidine (His, H)
n = 15 (2.9%)
Lysine (Lys, K)
n = 12 (2.32%)
Arginine (Arg, R)
n = 10 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 13 23 9 8 19 8 16 6 2 6 7 18 4 23 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 12 12 14 1 11 11 20 4 8 11 7 2 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 1 7 9 10 0 0 3 9 12 1 5 10 9 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 2 9 7 8 4 0 1 7 2 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 105 141 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 129 101 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 138 184 153
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 15 (6.58%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 14 (6.14%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 9 (3.95%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 24 (10.53%)
Methionine (Met, M)
n = 13 (5.7%)
Proline (Pro, P)
n = 12 (5.26%)
Phenylalanine (Phe, F)
n = 11 (4.82%)
Tyrosine (Tyr, Y)
n = 14 (6.14%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 6 (2.63%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 6 (2.63%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 7 12 6 1 15 1 7 9 0 2 2 4 1 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 4 5 6 0 0 5 1 2 0 4 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 1 2 2 8 2 1 3 6 8 1 0 3 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 12 1 5 5 4 0 1 1 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 56 65 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 62 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 64 99 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 28 (10.77%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 14 (5.38%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 10 (3.85%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 6 8 6 2 12 1 6 8 2 6 1 4 3 8 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 7 5 8 0 0 9 9 1 2 7 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 0 4 4 7 0 2 3 5 9 1 1 3 3 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 3 2 2 1 0 0 2 1 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 64 61 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 74 59 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 84 98 64
CYTB (size: 1137 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (5.82%)
Alanine (Ala, A)
n = 23 (6.08%)
Serine (Ser, S)
n = 30 (7.94%)
Threonine (Thr, T)
n = 40 (10.58%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 8 (2.12%)
Leucine (Leu, L)
n = 59 (15.61%)
Isoleucine (Ile, I)
n = 37 (9.79%)
Methionine (Met, M)
n = 13 (3.44%)
Proline (Pro, P)
n = 23 (6.08%)
Phenylalanine (Phe, F)
n = 28 (7.41%)
Tyrosine (Tyr, Y)
n = 12 (3.17%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.65%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 16 (4.23%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 13 (3.44%)
Lysine (Lys, K)
n = 10 (2.65%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 16 11 16 8 26 0 9 7 0 2 1 5 0 17 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 11 7 2 4 11 7 0 5 6 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 17 1 5 10 12 0 1 2 2 10 2 0 8 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 6 4 9 1 1 2 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 100 119 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 113 74 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 126 141 103
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 26 (8.2%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 34 (10.73%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 8 (2.52%)
Leucine (Leu, L)
n = 61 (19.24%)
Isoleucine (Ile, I)
n = 22 (6.94%)
Methionine (Met, M)
n = 22 (6.94%)
Proline (Pro, P)
n = 19 (5.99%)
Phenylalanine (Phe, F)
n = 17 (5.36%)
Tyrosine (Tyr, Y)
n = 15 (4.73%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 1 (0.32%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 6 19 8 8 39 0 6 6 1 0 3 5 0 12 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 11 12 0 4 6 2 0 3 8 7 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 17 0 0 8 11 0 1 2 6 9 1 0 6 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 1 2 7 0 1 3 2 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 89 101 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 98 57 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 91 151 67
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 13 (3.77%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 38 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 61 (17.68%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 36 (10.43%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 11 (3.19%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 20 (5.8%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 14 36 9 9 32 2 9 10 0 0 1 7 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 4 5 4 0 0 5 7 0 4 9 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 22 0 5 13 9 0 1 5 5 6 2 0 6 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 0 11 0 0 3 0 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 94 146 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 102 61 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 104 171 67
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 13 (3.77%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 38 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 61 (17.68%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 36 (10.43%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 11 (3.19%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 20 (5.8%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 14 36 9 9 32 2 9 10 0 0 1 7 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 4 5 4 0 0 5 7 0 4 9 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 22 0 5 13 9 0 1 5 5 6 2 0 6 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 0 11 0 0 3 0 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 94 146 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 102 61 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 104 171 67
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.72%)
Alanine (Ala, A)
n = 31 (6.78%)
Serine (Ser, S)
n = 38 (8.32%)
Threonine (Thr, T)
n = 46 (10.07%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 92 (20.13%)
Isoleucine (Ile, I)
n = 41 (8.97%)
Methionine (Met, M)
n = 36 (7.88%)
Proline (Pro, P)
n = 26 (5.69%)
Phenylalanine (Phe, F)
n = 19 (4.16%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 11 (2.41%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 23 (5.03%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 11 (2.41%)
Lysine (Lys, K)
n = 11 (2.41%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 17 31 16 11 45 4 16 6 2 1 2 6 0 10 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 3 6 10 13 2 2 9 6 0 3 8 14 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 22 2 4 9 11 2 0 12 3 12 0 0 10 13 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 1 0 2 11 0 1 1 7 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 130 169 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 129 79 197
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 134 207 98
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 11 (11.22%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 10 2 3 10 1 4 2 0 2 0 8 1 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 2 3 0 1 2 1 1 0 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 4 1 4 1 0 1 2 2 0 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 22 26 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 21 17 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 23 47 23
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.16%)
Alanine (Ala, A)
n = 39 (6.49%)
Serine (Ser, S)
n = 45 (7.49%)
Threonine (Thr, T)
n = 67 (11.15%)
Cysteine (Cys, C)
n = 4 (0.67%)
Valine (Val, V)
n = 20 (3.33%)
Leucine (Leu, L)
n = 94 (15.64%)
Isoleucine (Ile, I)
n = 49 (8.15%)
Methionine (Met, M)
n = 40 (6.66%)
Proline (Pro, P)
n = 28 (4.66%)
Phenylalanine (Phe, F)
n = 43 (7.15%)
Tyrosine (Tyr, Y)
n = 16 (2.66%)
Tryptophan (Trp, W)
n = 11 (1.83%)
Aspartic acid (Asp, D)
n = 8 (1.33%)
Glutamic acid (Glu, E)
n = 12 (2.0%)
Asparagine (Asn, N)
n = 40 (6.66%)
Glutamine (Gln, Q)
n = 18 (3.0%)
Histidine (His, H)
n = 14 (2.33%)
Lysine (Lys, K)
n = 20 (3.33%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 24 37 27 13 36 0 16 18 0 5 3 9 3 18 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 5 16 16 2 5 9 9 2 7 11 9 1 17
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 24 4 7 11 17 0 3 7 8 8 1 2 13 27 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 12 0 3 5 19 1 0 6 2 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 144 226 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
58 169 129 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 200 235 148
ND6 (size: 534 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.69%)
Alanine (Ala, A)
n = 11 (6.21%)
Serine (Ser, S)
n = 9 (5.08%)
Threonine (Thr, T)
n = 7 (3.95%)
Cysteine (Cys, C)
n = 2 (1.13%)
Valine (Val, V)
n = 24 (13.56%)
Leucine (Leu, L)
n = 23 (12.99%)
Isoleucine (Ile, I)
n = 9 (5.08%)
Methionine (Met, M)
n = 16 (9.04%)
Proline (Pro, P)
n = 5 (2.82%)
Phenylalanine (Phe, F)
n = 9 (5.08%)
Tyrosine (Tyr, Y)
n = 11 (6.21%)
Tryptophan (Trp, W)
n = 4 (2.26%)
Aspartic acid (Asp, D)
n = 5 (2.82%)
Glutamic acid (Glu, E)
n = 8 (4.52%)
Asparagine (Asn, N)
n = 3 (1.69%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.56%)
Lysine (Lys, K)
n = 2 (1.13%)
Arginine (Arg, R)
n = 2 (1.13%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 0 6 2 0 1 1 10 0 0 12 0 8 4 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 2 0 5 0 5 1 15 0 4 7 3 1 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 4 0 2 0 3 0 11 0 2 9 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 5 5 0 1 1 1 0 0 1 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 12 40 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 29 31 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 2 44 88
Total protein-coding genes (size: 11401 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 204 (5.37%)
Alanine (Ala, A)
n = 246 (6.48%)
Serine (Ser, S)
n = 278 (7.32%)
Threonine (Thr, T)
n = 359 (9.45%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 157 (4.13%)
Leucine (Leu, L)
n = 618 (16.28%)
Isoleucine (Ile, I)
n = 310 (8.16%)
Methionine (Met, M)
n = 256 (6.74%)
Proline (Pro, P)
n = 201 (5.29%)
Phenylalanine (Phe, F)
n = 225 (5.93%)
Tyrosine (Tyr, Y)
n = 142 (3.74%)
Tryptophan (Trp, W)
n = 101 (2.66%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 173 (4.56%)
Glutamine (Gln, Q)
n = 96 (2.53%)
Histidine (His, H)
n = 91 (2.4%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 61 (1.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
185 125 213 117 73 276 21 112 87 9 38 22 80 17 117 108
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 7 17 56 83 96 11 44 69 74 17 41 73 81 6 82
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
112 153 12 47 73 99 6 13 40 63 79 13 19 71 102 37
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
54 77 16 33 30 83 9 6 20 30 5 0 1 6 0 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
763 936 1244 854
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
444 1031 756 1566
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
205 1080 1555 957

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.