Viewing data for Balaenoptera musculus


Scientific name Balaenoptera musculus
Common name Blue whale
Maximum lifespan 110.00 years (Balaenoptera musculus@AnAge)

Total mtDNA (size: 16402 bases) GC AT G C A T
Base content (bases) 6667 9735 4527 2140 4361 5374
Base content per 1 kb (bases) 406 594 276 130 266 328
Base content (%) 40.6% 59.4%
Total protein-coding genes (size: 11349 bases) GC AT G C A T
Base content (bases) 4704 6645 3396 1308 3033 3612
Base content per 1 kb (bases) 414 586 299 115 267 318
Base content (%) 41.4% 58.6%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1521 bases) GC AT G C A T
Base content (bases) 555 966 323 232 429 537
Base content per 1 kb (bases) 365 635 212 153 282 353
Base content (%) 36.5% 63.5%
Total rRNA-coding genes (size: 2547 bases) GC AT G C A T
Base content (bases) 1024 1523 571 453 598 925
Base content per 1 kb (bases) 402 598 224 178 235 363
Base content (%) 40.2% 59.8%
12S rRNA gene (size: 972 bases) GC AT G C A T
Base content (bases) 409 563 229 180 215 348
Base content per 1 kb (bases) 421 579 236 185 221 358
Base content (%) 42.1% 57.9%
16S rRNA gene (size: 1575 bases) GC AT G C A T
Base content (bases) 615 960 342 273 383 577
Base content per 1 kb (bases) 390 610 217 173 243 366
Base content (%) 39.0% 61.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 261 420 194 67 202 218
Base content per 1 kb (bases) 383 617 285 98 297 320
Base content (%) 38.3% 61.7%
ATP8 (size: 192 bases) GC AT G C A T
Base content (bases) 69 123 59 10 50 73
Base content per 1 kb (bases) 359 641 307 52 260 380
Base content (%) 35.9% 64.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 656 895 406 250 450 445
Base content per 1 kb (bases) 423 577 262 161 290 287
Base content (%) 42.3% 57.7%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 277 407 188 89 170 237
Base content per 1 kb (bases) 405 595 275 130 249 346
Base content (%) 40.5% 59.5%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 339 447 231 108 225 222
Base content per 1 kb (bases) 431 569 294 137 286 282
Base content (%) 43.1% 56.9%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 504 636 351 153 295 341
Base content per 1 kb (bases) 442 558 308 134 259 299
Base content (%) 44.2% 55.8%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 400 557 292 108 248 309
Base content per 1 kb (bases) 418 582 305 113 259 323
Base content (%) 41.8% 58.2%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 413 631 325 88 261 370
Base content per 1 kb (bases) 396 604 311 84 250 354
Base content (%) 39.6% 60.4%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 147 199 107 40 92 107
Base content per 1 kb (bases) 425 575 309 116 266 309
Base content (%) 42.5% 57.5%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 569 809 427 142 377 432
Base content per 1 kb (bases) 413 587 310 103 274 313
Base content (%) 41.3% 58.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 126 171 89 37 89 82
Base content per 1 kb (bases) 424 576 300 125 300 276
Base content (%) 42.4% 57.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 764 1057 577 187 482 575
Base content per 1 kb (bases) 420 580 317 103 265 316
Base content (%) 42.0% 58.0%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 196 332 160 36 111 221
Base content per 1 kb (bases) 371 629 303 68 210 419
Base content (%) 37.1% 62.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 27 (11.95%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 41 (18.14%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 12 9 6 7 19 1 8 8 0 1 1 9 0 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 8 4 0 3 2 4 0 6 3 5 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 2 3 4 0 4 2 0 2 0 0 4 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 1 0 5 0 3 0 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 66 85 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 65 37 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 63 96 64
ATP8 (size: 192 bases)
Amino acid sequence: MPQLDTSTWLLTILSMLLTLFVLFQLKISKHSYSPNPKLVPTKTQKQQTPWNITWTKIYLPLL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (7.94%)
Threonine (Thr, T)
n = 9 (14.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.17%)
Leucine (Leu, L)
n = 13 (20.63%)
Isoleucine (Ile, I)
n = 4 (6.35%)
Methionine (Met, M)
n = 2 (3.17%)
Proline (Pro, P)
n = 6 (9.52%)
Phenylalanine (Phe, F)
n = 2 (3.17%)
Tyrosine (Tyr, Y)
n = 2 (3.17%)
Tryptophan (Trp, W)
n = 3 (4.76%)
Aspartic acid (Asp, D)
n = 1 (1.59%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.17%)
Glutamine (Gln, Q)
n = 5 (7.94%)
Histidine (His, H)
n = 1 (1.59%)
Lysine (Lys, K)
n = 6 (9.52%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 1 3 2 4 0 3 5 0 0 0 2 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 2 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 1 1 2 2 0 0 0 1 1 0 1 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 1 5 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 21 23 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 20 18 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 18 32 10
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.3%)
Alanine (Ala, A)
n = 39 (7.56%)
Serine (Ser, S)
n = 30 (5.81%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.17%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 31 (6.01%)
Proline (Pro, P)
n = 29 (5.62%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 18 (3.49%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 19 (3.68%)
Glutamine (Gln, Q)
n = 6 (1.16%)
Histidine (His, H)
n = 17 (3.29%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 17 22 5 7 31 3 15 4 2 6 11 16 4 10 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 0 7 15 17 0 10 16 21 1 16 4 9 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 20 1 2 8 16 1 1 2 11 8 1 0 9 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 1 6 9 9 0 1 2 5 0 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 106 140 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 134 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 166 211 117
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 12 13 1 6 20 0 7 6 0 2 5 6 1 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 0 4 4 0 0 5 3 0 2 4 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 9 2 3 3 9 0 2 3 5 4 0 0 0 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 1 2 9 4 1 1 0 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 59 65 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 59 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 74 113 34
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.66%)
Alanine (Ala, A)
n = 13 (4.98%)
Serine (Ser, S)
n = 21 (8.05%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.75%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 17 (6.51%)
Methionine (Met, M)
n = 9 (3.45%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.07%)
Asparagine (Asn, N)
n = 7 (2.68%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 17 (6.51%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 6 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 8 8 6 5 16 0 6 6 1 3 3 9 0 8 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 3 7 3 0 3 9 8 0 3 5 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 4 3 10 0 0 4 3 8 0 0 2 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 1 2 2 1 1 3 2 0 0 0 0 1 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 69 62 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 64 57 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 98 103 56
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 21 (5.54%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 36 (9.5%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 14 (3.69%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 21 14 3 15 29 3 9 6 0 2 9 8 2 7 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 7 16 0 4 13 7 0 1 9 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 2 2 7 8 0 2 2 5 10 1 0 2 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 4 8 10 0 0 1 7 1 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 101 109 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 93 76 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 157 156 55
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 30 (9.43%)
Serine (Ser, S)
n = 21 (6.6%)
Threonine (Thr, T)
n = 25 (7.86%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 11 (3.46%)
Leucine (Leu, L)
n = 57 (17.92%)
Isoleucine (Ile, I)
n = 25 (7.86%)
Methionine (Met, M)
n = 19 (5.97%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 20 (6.29%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 14 (4.4%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 13 16 6 8 39 0 3 7 0 0 1 10 0 5 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 13 13 0 1 6 4 1 5 9 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 16 1 1 9 8 0 1 2 5 6 0 1 3 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 0 1 2 6 1 0 1 7 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 94 93 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 95 58 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 103 158 51
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 20 (5.76%)
Serine (Ser, S)
n = 25 (7.2%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 34 (9.8%)
Methionine (Met, M)
n = 31 (8.93%)
Proline (Pro, P)
n = 23 (6.63%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 19 26 6 13 34 1 8 11 0 2 1 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 11 7 0 1 5 7 1 3 10 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 27 1 1 11 10 0 0 3 4 6 0 0 4 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 10 2 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 95 142 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 112 57 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 118 171 48
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 20 (5.76%)
Serine (Ser, S)
n = 25 (7.2%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 34 (9.8%)
Methionine (Met, M)
n = 31 (8.93%)
Proline (Pro, P)
n = 23 (6.63%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 19 26 6 13 34 1 8 11 0 2 1 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 11 7 0 1 5 7 1 3 10 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 27 1 1 11 10 0 0 3 4 6 0 0 4 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 10 2 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 95 142 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 112 57 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 118 171 48
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 33 (7.21%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 33 (7.21%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 33 (7.21%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 25 28 19 19 46 2 12 10 0 0 8 7 0 4 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 6 14 12 1 2 6 8 1 4 13 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 2 3 14 10 0 2 8 8 7 0 0 7 15 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 1 1 2 12 0 1 3 6 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 144 152 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 117 85 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 166 195 86
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 2 (2.04%)
Valine (Val, V)
n = 9 (9.18%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 1 (1.02%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 8 2 7 10 0 4 2 0 4 2 2 1 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 2 4 4 0 0 3 1 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 0 4 2 0 0 2 3 1 0 0 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 26 27 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 22 17 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 41 38 17
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.46%)
Alanine (Ala, A)
n = 40 (6.6%)
Serine (Ser, S)
n = 41 (6.77%)
Threonine (Thr, T)
n = 61 (10.07%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 16 (2.64%)
Leucine (Leu, L)
n = 101 (16.67%)
Isoleucine (Ile, I)
n = 55 (9.08%)
Methionine (Met, M)
n = 30 (4.95%)
Proline (Pro, P)
n = 32 (5.28%)
Phenylalanine (Phe, F)
n = 46 (7.59%)
Tyrosine (Tyr, Y)
n = 16 (2.64%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 21 (3.47%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 39 30 11 28 40 5 16 20 1 2 5 8 1 15 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 2 5 5 22 13 0 2 8 17 0 10 12 10 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 28 0 6 15 10 1 1 8 5 11 4 1 10 25 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 3 3 9 20 2 1 4 3 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 158 212 131
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 165 131 248
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 254 232 103
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.43%)
Alanine (Ala, A)
n = 8 (4.57%)
Serine (Ser, S)
n = 15 (8.57%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 29 (16.57%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 5 (2.86%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 3 (1.71%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 2 (1.14%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 0 1 0 0 2 0 9 0 1 15 0 6 8 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 4 0 2 2 9 1 9 8 3 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 2 5 0 2 1 7 0 8 1 4 7 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 4 3 0 1 3 0 0 0 1 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 7 43 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 27 28 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 2 40 89
Total protein-coding genes (size: 11405 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.61%)
Alanine (Ala, A)
n = 253 (6.66%)
Serine (Ser, S)
n = 265 (6.97%)
Threonine (Thr, T)
n = 332 (8.74%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 190 (5.0%)
Leucine (Leu, L)
n = 628 (16.53%)
Isoleucine (Ile, I)
n = 319 (8.39%)
Methionine (Met, M)
n = 218 (5.74%)
Proline (Pro, P)
n = 208 (5.47%)
Phenylalanine (Phe, F)
n = 237 (6.24%)
Tyrosine (Tyr, Y)
n = 126 (3.32%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 156 (4.11%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 98 (2.58%)
Lysine (Lys, K)
n = 97 (2.55%)
Arginine (Arg, R)
n = 67 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
141 178 181 72 122 304 16 104 88 5 37 46 90 17 78 159
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
37 8 16 41 112 97 3 35 75 91 12 59 73 76 0 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
94 165 12 30 81 93 3 20 38 59 67 10 10 45 111 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
70 80 13 24 44 86 11 8 16 41 2 2 0 7 2 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
817 980 1182 822
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
469 1000 740 1592
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
153 1302 1600 746

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.