Viewing data for Aratinga acuticaudata


Scientific name Aratinga acuticaudata
Common name Blue-crowned conure
Maximum lifespan 31.00 years (Aratinga acuticaudata@AnAge)

Total mtDNA (size: 16998 bases) GC AT G C A T
Base content (bases) 7869 9128 5495 2374 3970 5158
Base content per 1 kb (bases) 463 537 323 140 234 303
Base content (%) 46.3% 53.7%
Total protein-coding genes (size: 11380 bases) GC AT G C A T
Base content (bases) 5299 6081 3882 1417 2657 3424
Base content per 1 kb (bases) 466 534 341 125 233 301
Base content (%) 46.6% 53.4%
D-loop (size: 1482 bases) GC AT G C A T
Base content (bases) 643 839 415 228 462 377
Base content per 1 kb (bases) 434 566 280 154 312 254
Base content (%) 43.4% 56.6%
Total tRNA-coding genes (size: 1534 bases) GC AT G C A T
Base content (bases) 654 879 398 256 375 504
Base content per 1 kb (bases) 426 573 259 167 244 329
Base content (%) 42.6% 57.3%
Total rRNA-coding genes (size: 2552 bases) GC AT G C A T
Base content (bases) 1252 1300 778 474 465 835
Base content per 1 kb (bases) 491 509 305 186 182 327
Base content (%) 49.1% 50.9%
12S rRNA gene (size: 977 bases) GC AT G C A T
Base content (bases) 484 493 301 183 177 316
Base content per 1 kb (bases) 495 505 308 187 181 323
Base content (%) 49.5% 50.5%
16S rRNA gene (size: 1575 bases) GC AT G C A T
Base content (bases) 768 807 477 291 288 519
Base content per 1 kb (bases) 488 512 303 185 183 330
Base content (%) 48.8% 51.2%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 318 366 254 64 160 206
Base content per 1 kb (bases) 465 535 371 94 234 301
Base content (%) 46.5% 53.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 71 97 64 7 38 59
Base content per 1 kb (bases) 423 577 381 42 226 351
Base content (%) 42.3% 57.7%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 747 801 476 271 381 420
Base content per 1 kb (bases) 483 517 307 175 246 271
Base content (%) 48.3% 51.7%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 335 349 235 100 147 202
Base content per 1 kb (bases) 490 510 344 146 215 295
Base content (%) 49.0% 51.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 375 409 252 123 192 217
Base content per 1 kb (bases) 478 522 321 157 245 277
Base content (%) 47.8% 52.2%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 533 607 391 142 290 317
Base content per 1 kb (bases) 468 532 343 125 254 278
Base content (%) 46.8% 53.2%
ND1 (size: 981 bases) GC AT G C A T
Base content (bases) 469 512 340 129 250 262
Base content per 1 kb (bases) 478 522 347 131 255 267
Base content (%) 47.8% 52.2%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 460 580 368 92 249 331
Base content per 1 kb (bases) 442 558 354 88 239 318
Base content (%) 44.2% 55.8%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 162 189 118 44 87 102
Base content per 1 kb (bases) 462 538 336 125 248 291
Base content (%) 46.2% 53.8%
ND4 (size: 1393 bases) GC AT G C A T
Base content (bases) 647 746 500 147 330 416
Base content per 1 kb (bases) 464 536 359 106 237 299
Base content (%) 46.4% 53.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 137 160 96 41 76 84
Base content per 1 kb (bases) 461 539 323 138 256 283
Base content (%) 46.1% 53.9%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 805 1010 602 203 411 599
Base content per 1 kb (bases) 444 556 332 112 226 330
Base content (%) 44.4% 55.6%
ND6 (size: 513 bases) GC AT G C A T
Base content (bases) 244 269 188 56 52 217
Base content per 1 kb (bases) 476 524 366 109 101 423
Base content (%) 47.6% 52.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 26 (11.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 58 (25.55%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 18 (7.93%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 18 10 6 18 26 2 6 8 0 0 3 4 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 11 5 0 1 3 3 1 5 6 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 1 0 4 5 0 0 4 3 1 0 0 0 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 1 0 3 0 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 86 76 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 69 33 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 99 97 25
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWLFIMITSWLTFSLIFQPKTLSFTSTNPLINKTPTITKNLPWIWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 6 1 0 4 3 0 0 2 0 0 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 5 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 0 0 3 2 0 0 0 0 0 0 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
0 17 24 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 21 11 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 26 24 4
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 48 (9.32%)
Serine (Ser, S)
n = 26 (5.05%)
Threonine (Thr, T)
n = 39 (7.57%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (6.99%)
Leucine (Leu, L)
n = 63 (12.23%)
Isoleucine (Ile, I)
n = 39 (7.57%)
Methionine (Met, M)
n = 23 (4.47%)
Proline (Pro, P)
n = 31 (6.02%)
Phenylalanine (Phe, F)
n = 41 (7.96%)
Tyrosine (Tyr, Y)
n = 17 (3.3%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.69%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 29 17 10 7 36 4 5 8 2 4 11 13 8 8 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 9 20 19 0 5 13 24 5 4 10 16 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 13 4 4 11 8 0 0 3 4 13 1 1 3 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 4 3 12 8 1 3 0 5 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
156 125 130 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 141 96 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 210 194 74
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 14 (6.17%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 17 8 2 10 14 4 3 5 3 2 3 6 0 0 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 0 13 0 0 0 2 5 1 0 5 9 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 6 0 2 8 7 0 0 2 4 3 0 0 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 9 5 1 13 4 0 0 3 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 65 58 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 60 60 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 110 84 17
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 19 (7.31%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 36 (13.85%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 12 6 3 9 17 4 2 9 0 3 5 7 1 4 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 5 5 8 1 1 4 12 2 1 6 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 9 0 2 5 6 0 3 2 3 6 0 1 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 5 3 2 2 2 1 0 0 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 76 58 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 68 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 108 104 33
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.07%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 28 (7.39%)
Threonine (Thr, T)
n = 29 (7.65%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 14 (3.69%)
Leucine (Leu, L)
n = 66 (17.41%)
Isoleucine (Ile, I)
n = 31 (8.18%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 25 (6.6%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 23 8 6 13 37 4 5 6 1 1 4 8 1 6 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 5 15 6 0 5 8 8 2 3 14 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 10 0 2 12 9 2 1 2 3 11 4 1 4 17 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 1 2 4 10 0 0 1 7 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 112 103 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 105 78 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 174 136 53
ND1 (size: 981 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.99%)
Alanine (Ala, A)
n = 29 (8.9%)
Serine (Ser, S)
n = 31 (9.51%)
Threonine (Thr, T)
n = 22 (6.75%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.68%)
Leucine (Leu, L)
n = 67 (20.55%)
Isoleucine (Ile, I)
n = 19 (5.83%)
Methionine (Met, M)
n = 14 (4.29%)
Proline (Pro, P)
n = 27 (8.28%)
Phenylalanine (Phe, F)
n = 18 (5.52%)
Tyrosine (Tyr, Y)
n = 15 (4.6%)
Tryptophan (Trp, W)
n = 9 (2.76%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.37%)
Asparagine (Asn, N)
n = 12 (3.68%)
Glutamine (Gln, Q)
n = 5 (1.53%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 14 12 12 22 23 6 4 5 0 1 5 5 1 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 11 12 1 2 5 5 1 5 8 12 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 1 4 10 10 1 2 4 3 12 2 0 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 0 4 4 3 0 2 5 1 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 106 81 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 103 57 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 131 124 49
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 22 (6.38%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 51 (14.78%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 22 17 6 17 29 9 5 9 0 0 2 3 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 6 10 6 0 4 4 4 0 2 12 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 23 0 5 12 13 0 0 5 1 7 2 0 1 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 1 11 2 0 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 101 133 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 125 54 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 142 143 46
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 22 (6.38%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 51 (14.78%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 22 17 6 17 29 9 5 9 0 0 2 3 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 6 10 6 0 4 4 4 0 2 12 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 23 0 5 12 13 0 0 5 1 7 2 0 1 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 1 11 2 0 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 101 133 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 125 54 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 142 143 46
ND4 (size: 1393 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.67%)
Alanine (Ala, A)
n = 30 (6.48%)
Serine (Ser, S)
n = 38 (8.21%)
Threonine (Thr, T)
n = 56 (12.1%)
Cysteine (Cys, C)
n = 6 (1.3%)
Valine (Val, V)
n = 9 (1.94%)
Leucine (Leu, L)
n = 104 (22.46%)
Isoleucine (Ile, I)
n = 35 (7.56%)
Methionine (Met, M)
n = 24 (5.18%)
Proline (Pro, P)
n = 34 (7.34%)
Phenylalanine (Phe, F)
n = 11 (2.38%)
Tyrosine (Tyr, Y)
n = 13 (2.81%)
Tryptophan (Trp, W)
n = 11 (2.38%)
Aspartic acid (Asp, D)
n = 2 (0.43%)
Glutamic acid (Glu, E)
n = 9 (1.94%)
Asparagine (Asn, N)
n = 12 (2.59%)
Glutamine (Gln, Q)
n = 15 (3.24%)
Histidine (His, H)
n = 17 (3.67%)
Lysine (Lys, K)
n = 11 (2.38%)
Arginine (Arg, R)
n = 10 (2.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 23 18 16 28 40 5 14 12 3 0 5 4 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 3 1 18 10 1 2 4 10 1 6 14 13 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 25 1 2 14 10 0 3 9 2 11 0 1 2 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 2 0 2 8 3 2 3 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 165 150 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 146 79 183
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 189 187 64
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 16 (16.33%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 5 2 4 10 3 1 3 0 0 1 1 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 2 0 4 4 1 0 2 2 0 1 0 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 6 0 4 3 4 0 2 3 0 1 0 0 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 0 1 0 0 1 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 32 24 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 31 15 36
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 33 45 16
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.3%)
Alanine (Ala, A)
n = 52 (8.61%)
Serine (Ser, S)
n = 46 (7.62%)
Threonine (Thr, T)
n = 74 (12.25%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 10 (1.66%)
Leucine (Leu, L)
n = 108 (17.88%)
Isoleucine (Ile, I)
n = 48 (7.95%)
Methionine (Met, M)
n = 32 (5.3%)
Proline (Pro, P)
n = 31 (5.13%)
Phenylalanine (Phe, F)
n = 34 (5.63%)
Tyrosine (Tyr, Y)
n = 12 (1.99%)
Tryptophan (Trp, W)
n = 11 (1.82%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 12 (1.99%)
Asparagine (Asn, N)
n = 23 (3.81%)
Glutamine (Gln, Q)
n = 18 (2.98%)
Histidine (His, H)
n = 14 (2.32%)
Lysine (Lys, K)
n = 26 (4.3%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 41 29 12 21 59 3 12 18 0 2 2 4 2 4 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 2 12 27 13 0 3 6 18 5 4 10 16 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
36 33 1 6 13 14 0 2 11 3 9 1 1 2 21 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 3 2 6 26 0 0 1 7 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
114 166 216 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 190 114 232
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 246 269 70
ND6 (size: 513 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.47%)
Alanine (Ala, A)
n = 12 (7.06%)
Serine (Ser, S)
n = 15 (8.82%)
Threonine (Thr, T)
n = 2 (1.18%)
Cysteine (Cys, C)
n = 1 (0.59%)
Valine (Val, V)
n = 32 (18.82%)
Leucine (Leu, L)
n = 25 (14.71%)
Isoleucine (Ile, I)
n = 1 (0.59%)
Methionine (Met, M)
n = 6 (3.53%)
Proline (Pro, P)
n = 5 (2.94%)
Phenylalanine (Phe, F)
n = 16 (9.41%)
Tyrosine (Tyr, Y)
n = 7 (4.12%)
Tryptophan (Trp, W)
n = 6 (3.53%)
Aspartic acid (Asp, D)
n = 4 (2.35%)
Glutamic acid (Glu, E)
n = 1 (0.59%)
Asparagine (Asn, N)
n = 1 (0.59%)
Glutamine (Gln, Q)
n = 1 (0.59%)
Histidine (His, H)
n = 2 (1.18%)
Lysine (Lys, K)
n = 1 (0.59%)
Arginine (Arg, R)
n = 4 (2.35%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 1 3 0 0 5 3 0 1 16 1 5 10 15 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 6 0 3 3 9 0 4 15 4 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 5 3 1 1 5 0 7 0 6 14 0 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 1 4 0 0 1 0 0 0 4 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 20 16 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 29 18 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
67 7 18 79
Total protein-coding genes (size: 11397 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.72%)
Alanine (Ala, A)
n = 283 (7.46%)
Serine (Ser, S)
n = 297 (7.82%)
Threonine (Thr, T)
n = 365 (9.62%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 156 (4.11%)
Leucine (Leu, L)
n = 677 (17.83%)
Isoleucine (Ile, I)
n = 281 (7.4%)
Methionine (Met, M)
n = 172 (4.53%)
Proline (Pro, P)
n = 239 (6.3%)
Phenylalanine (Phe, F)
n = 216 (5.69%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 90 (2.37%)
Asparagine (Asn, N)
n = 125 (3.29%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 105 (2.77%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
66 215 138 79 158 309 50 61 88 10 30 42 61 23 54 162
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
34 12 16 51 138 87 7 33 51 98 35 36 92 105 6 35
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
170 152 8 37 102 91 4 18 45 33 76 16 20 15 110 20
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
85 68 22 15 48 80 12 6 14 41 7 0 2 6 1 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
809 1106 1100 782
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
485 1121 689 1502
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
257 1524 1476 540

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.