Viewing data for Argyrosomus japonicus


Scientific name Argyrosomus japonicus
Common name Southern meagre
Maximum lifespan 30.00 years (Argyrosomus japonicus@AnAge)

Total mtDNA (size: 16496 bases) GC AT G C A T
Base content (bases) 7871 8625 5117 2754 4172 4453
Base content per 1 kb (bases) 477 523 310 167 253 270
Base content (%) 47.7% 52.3%
Total protein-coding genes (size: 11413 bases) GC AT G C A T
Base content (bases) 5571 5842 3823 1748 2980 2862
Base content per 1 kb (bases) 488 512 335 153 261 251
Base content (%) 48.8% 51.2%
D-loop (size: 825 bases) GC AT G C A T
Base content (bases) 308 517 183 125 252 265
Base content per 1 kb (bases) 373 627 222 152 305 321
Base content (%) 37.3% 62.7%
Total tRNA-coding genes (size: 1550 bases) GC AT G C A T
Base content (bases) 704 846 388 316 376 470
Base content per 1 kb (bases) 454 546 250 204 243 303
Base content (%) 45.4% 54.6%
Total rRNA-coding genes (size: 2642 bases) GC AT G C A T
Base content (bases) 1252 1390 698 554 548 842
Base content per 1 kb (bases) 474 526 264 210 207 319
Base content (%) 47.4% 52.6%
12S rRNA gene (size: 948 bases) GC AT G C A T
Base content (bases) 459 489 248 211 198 291
Base content per 1 kb (bases) 484 516 262 223 209 307
Base content (%) 48.4% 51.6%
16S rRNA gene (size: 1694 bases) GC AT G C A T
Base content (bases) 793 901 450 343 350 551
Base content per 1 kb (bases) 468 532 266 202 207 325
Base content (%) 46.8% 53.2%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 335 349 239 96 188 161
Base content per 1 kb (bases) 490 510 349 140 275 235
Base content (%) 49.0% 51.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 53 19 40 56
Base content per 1 kb (bases) 429 571 315 113 238 333
Base content (%) 42.9% 57.1%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 766 791 460 306 435 356
Base content per 1 kb (bases) 492 508 295 197 279 229
Base content (%) 49.2% 50.8%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 313 378 200 113 191 187
Base content per 1 kb (bases) 453 547 289 164 276 271
Base content (%) 45.3% 54.7%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 377 408 251 126 219 189
Base content per 1 kb (bases) 480 520 320 161 279 241
Base content (%) 48.0% 52.0%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 577 564 396 181 312 252
Base content per 1 kb (bases) 506 494 347 159 273 221
Base content (%) 50.6% 49.4%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 478 497 325 153 272 225
Base content per 1 kb (bases) 490 510 333 157 279 231
Base content (%) 49.0% 51.0%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 507 539 377 130 268 271
Base content per 1 kb (bases) 485 515 360 124 256 259
Base content (%) 48.5% 51.5%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 182 167 122 60 101 66
Base content per 1 kb (bases) 521 479 350 172 289 189
Base content (%) 52.1% 47.9%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 686 695 478 208 348 347
Base content per 1 kb (bases) 497 503 346 151 252 251
Base content (%) 49.7% 50.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 158 139 116 42 75 64
Base content per 1 kb (bases) 532 468 391 141 253 215
Base content (%) 53.2% 46.8%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 870 969 625 245 468 501
Base content per 1 kb (bases) 473 527 340 133 254 272
Base content (%) 47.3% 52.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 255 267 183 72 70 197
Base content per 1 kb (bases) 489 511 351 138 134 377
Base content (%) 48.9% 51.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 57 (25.11%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 8 3 12 14 16 8 6 6 3 4 4 5 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 3 12 1 1 2 4 3 2 4 9 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 0 2 4 0 1 1 3 2 3 1 1 1 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 1 1 0 2 1 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 84 63 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 65 32 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 90 66 48
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWLAIMVFSWLTFLIIIPPKIMAHIFPNEPTPQSTEKSKTETWNWPWL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 2 1 0 1 1 1 1 1 0 1 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 2 0 0 0 0 0 0 2 3 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 0 2 1 0 0 1 0 0 1 1 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 1 0 0 2 1 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 15 21 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 19 13 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 19 22 8
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.07%)
Alanine (Ala, A)
n = 48 (9.27%)
Serine (Ser, S)
n = 27 (5.21%)
Threonine (Thr, T)
n = 37 (7.14%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.49%)
Leucine (Leu, L)
n = 66 (12.74%)
Isoleucine (Ile, I)
n = 34 (6.56%)
Methionine (Met, M)
n = 24 (4.63%)
Proline (Pro, P)
n = 29 (5.6%)
Phenylalanine (Phe, F)
n = 41 (7.92%)
Tyrosine (Tyr, Y)
n = 19 (3.67%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 14 (2.7%)
Glutamine (Gln, Q)
n = 8 (1.54%)
Histidine (His, H)
n = 19 (3.67%)
Lysine (Lys, K)
n = 8 (1.54%)
Arginine (Arg, R)
n = 10 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 11 6 14 23 13 6 8 6 2 9 15 15 5 16 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
18 0 1 11 22 12 3 6 16 17 8 9 14 5 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 20 3 3 10 7 1 2 4 4 15 3 2 3 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 5 5 3 12 8 0 3 2 2 3 1 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
164 122 124 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
82 135 93 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
60 203 139 117
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 12 (5.24%)
Threonine (Thr, T)
n = 14 (6.11%)
Cysteine (Cys, C)
n = 3 (1.31%)
Valine (Val, V)
n = 15 (6.55%)
Leucine (Leu, L)
n = 32 (13.97%)
Isoleucine (Ile, I)
n = 22 (9.61%)
Methionine (Met, M)
n = 11 (4.8%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 7 (3.06%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 8 4 14 7 8 1 2 8 0 3 4 5 3 5 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 3 7 7 0 2 4 1 2 6 5 3 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 0 2 5 2 1 0 2 2 7 2 0 1 3 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 3 4 9 4 0 0 2 4 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 68 57 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 63 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 77 67 67
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 5 8 9 9 4 4 8 0 4 6 4 0 10 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 1 15 4 1 4 10 6 2 0 11 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 2 5 5 0 1 2 8 3 1 0 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 7 2 1 4 2 0 1 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 72 52 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 67 53 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 112 83 55
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 32 (8.44%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 21 (5.54%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 23 (6.07%)
Leucine (Leu, L)
n = 66 (17.41%)
Isoleucine (Ile, I)
n = 29 (7.65%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 16 3 16 24 12 10 4 5 1 4 10 8 1 7 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 3 18 11 0 2 18 4 2 4 12 3 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 1 4 11 6 0 0 1 8 6 3 0 4 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 2 4 1 10 9 0 0 3 5 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 111 86 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 96 76 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 189 90 70
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 35 (10.8%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 20 (6.17%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 20 (6.17%)
Leucine (Leu, L)
n = 64 (19.75%)
Isoleucine (Ile, I)
n = 23 (7.1%)
Methionine (Met, M)
n = 9 (2.78%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 5 17 17 17 5 8 7 0 7 9 3 1 9 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 21 9 0 2 8 4 4 8 11 4 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 2 0 11 4 2 1 3 5 7 1 0 5 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 4 0 4 6 1 1 1 4 2 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 99 74 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 96 57 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 130 94 74
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 18 (5.19%)
Threonine (Thr, T)
n = 45 (12.97%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.44%)
Leucine (Leu, L)
n = 85 (24.5%)
Isoleucine (Ile, I)
n = 21 (6.05%)
Methionine (Met, M)
n = 11 (3.17%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 15 (4.32%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 12 (3.46%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 6 19 29 15 6 12 14 0 0 2 2 1 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 3 22 12 0 3 9 6 1 2 11 6 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 15 2 3 6 6 1 0 2 3 6 2 4 5 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 1 1 2 7 1 1 1 1 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 114 99 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 118 57 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 145 114 63
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 18 (5.19%)
Threonine (Thr, T)
n = 45 (12.97%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.44%)
Leucine (Leu, L)
n = 85 (24.5%)
Isoleucine (Ile, I)
n = 21 (6.05%)
Methionine (Met, M)
n = 11 (3.17%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 15 (4.32%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 12 (3.46%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 6 19 29 15 6 12 14 0 0 2 2 1 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 3 22 12 0 3 9 6 1 2 11 6 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 15 2 3 6 6 1 0 2 3 6 2 4 5 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 1 1 2 7 1 1 1 1 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 114 99 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 118 57 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 145 114 63
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (5.88%)
Alanine (Ala, A)
n = 41 (8.93%)
Serine (Ser, S)
n = 25 (5.45%)
Threonine (Thr, T)
n = 42 (9.15%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 17 (3.7%)
Leucine (Leu, L)
n = 100 (21.79%)
Isoleucine (Ile, I)
n = 31 (6.75%)
Methionine (Met, M)
n = 23 (5.01%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 18 (3.92%)
Tyrosine (Tyr, Y)
n = 12 (2.61%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 13 (2.83%)
Asparagine (Asn, N)
n = 14 (3.05%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 17 15 17 39 26 9 8 10 1 3 7 6 1 9 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 3 4 24 13 0 6 15 1 5 4 16 6 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 12 3 5 5 8 0 3 4 4 8 0 1 2 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 5 1 2 7 3 0 3 7 1 0 0 0 0 19
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
101 152 127 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 129 74 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 197 146 78
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 2 2 7 13 1 1 3 0 1 1 0 0 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 0 8 3 1 0 3 2 0 0 2 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 0 0 1 6 3 0 1 1 0 0 1 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 0 2 0 0 0 1 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 35 18 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 32 14 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 49 32 13
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.9%)
Alanine (Ala, A)
n = 56 (9.15%)
Serine (Ser, S)
n = 42 (6.86%)
Threonine (Thr, T)
n = 62 (10.13%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 23 (3.76%)
Leucine (Leu, L)
n = 99 (16.18%)
Isoleucine (Ile, I)
n = 44 (7.19%)
Methionine (Met, M)
n = 29 (4.74%)
Proline (Pro, P)
n = 31 (5.07%)
Phenylalanine (Phe, F)
n = 46 (7.52%)
Tyrosine (Tyr, Y)
n = 9 (1.47%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 32 (5.23%)
Glutamine (Gln, Q)
n = 19 (3.1%)
Histidine (His, H)
n = 15 (2.45%)
Lysine (Lys, K)
n = 21 (3.43%)
Arginine (Arg, R)
n = 10 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 22 20 24 35 27 6 7 15 4 5 11 4 3 20 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 6 5 34 15 2 2 19 5 4 9 16 4 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 23 2 1 16 12 1 1 11 2 7 1 0 9 23 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 3 4 8 18 3 0 3 7 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
133 167 200 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 179 121 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 279 180 114
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (15.03%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 25 (14.45%)
Leucine (Leu, L)
n = 30 (17.34%)
Isoleucine (Ile, I)
n = 5 (2.89%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 0 5 1 1 3 11 0 0 10 0 5 10 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 7 2 2 6 6 2 2 16 4 1 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 4 0 2 3 4 0 7 2 2 9 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 6 2 0 0 0 1 0 0 4 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 23 21 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 37 21 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
66 12 28 68
Total protein-coding genes (size: 11435 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 246 (6.46%)
Alanine (Ala, A)
n = 345 (9.06%)
Serine (Ser, S)
n = 227 (5.96%)
Threonine (Thr, T)
n = 315 (8.27%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 207 (5.44%)
Leucine (Leu, L)
n = 691 (18.15%)
Isoleucine (Ile, I)
n = 259 (6.8%)
Methionine (Met, M)
n = 144 (3.78%)
Proline (Pro, P)
n = 221 (5.8%)
Phenylalanine (Phe, F)
n = 238 (6.25%)
Tyrosine (Tyr, Y)
n = 111 (2.91%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 75 (1.97%)
Glutamic acid (Glu, E)
n = 101 (2.65%)
Asparagine (Asn, N)
n = 121 (3.18%)
Glutamine (Gln, Q)
n = 98 (2.57%)
Histidine (His, H)
n = 106 (2.78%)
Lysine (Lys, K)
n = 74 (1.94%)
Arginine (Arg, R)
n = 79 (2.07%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
141 118 71 153 214 166 64 74 85 13 50 74 57 26 101 137
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
73 5 19 47 195 89 14 35 112 53 46 54 116 39 12 48
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
132 122 13 27 84 58 10 14 34 47 64 20 20 33 88 16
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
90 65 36 17 58 64 10 9 18 39 13 1 0 6 0 100
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
974 1101 962 772
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
518 1060 692 1539
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
370 1553 1089 797

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.