Viewing data for Paleosuchus trigonatus


Scientific name Paleosuchus trigonatus
Common name Smooth-fronted caiman
Maximum lifespan 30.90 years (Paleosuchus trigonatus@AnAge)

Total mtDNA (size: 15948 bases) GC AT G C A T
Base content (bases) 7558 8390 5408 2150 3482 4908
Base content per 1 kb (bases) 474 526 339 135 218 308
Base content (%) 47.4% 52.6%
Total protein-coding genes (size: 11347 bases) GC AT G C A T
Base content (bases) 5438 5909 4070 1368 2528 3381
Base content per 1 kb (bases) 479 521 359 121 223 298
Base content (%) 47.9% 52.1%
D-loop (size: 338 bases) GC AT G C A T
Base content (bases) 171 167 125 46 98 69
Base content per 1 kb (bases) 506 494 370 136 290 204
Base content (%) 50.6% 49.4%
Total tRNA-coding genes (size: 1552 bases) GC AT G C A T
Base content (bases) 682 870 423 259 353 517
Base content per 1 kb (bases) 439 561 273 167 227 333
Base content (%) 43.9% 56.1%
Total rRNA-coding genes (size: 2566 bases) GC AT G C A T
Base content (bases) 1182 1384 714 468 484 900
Base content per 1 kb (bases) 461 539 278 182 189 351
Base content (%) 46.1% 53.9%
12S rRNA gene (size: 980 bases) GC AT G C A T
Base content (bases) 458 522 271 187 186 336
Base content per 1 kb (bases) 467 533 277 191 190 343
Base content (%) 46.7% 53.3%
16S rRNA gene (size: 1586 bases) GC AT G C A T
Base content (bases) 724 862 443 281 298 564
Base content per 1 kb (bases) 456 544 279 177 188 356
Base content (%) 45.6% 54.4%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 324 360 263 61 142 218
Base content per 1 kb (bases) 474 526 385 89 208 319
Base content (%) 47.4% 52.6%
ATP8 (size: 169 bases) GC AT G C A T
Base content (bases) 81 88 66 15 30 58
Base content per 1 kb (bases) 479 521 391 89 178 343
Base content (%) 47.9% 52.1%
COX1 (size: 1555 bases) GC AT G C A T
Base content (bases) 738 817 500 238 377 440
Base content per 1 kb (bases) 475 525 322 153 242 283
Base content (%) 47.5% 52.5%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 320 368 233 87 151 217
Base content per 1 kb (bases) 465 535 339 126 219 315
Base content (%) 46.5% 53.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 394 390 277 117 191 199
Base content per 1 kb (bases) 503 497 353 149 244 254
Base content (%) 50.3% 49.7%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 577 566 422 155 266 300
Base content per 1 kb (bases) 505 495 369 136 233 262
Base content (%) 50.5% 49.5%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 467 499 340 127 238 261
Base content per 1 kb (bases) 483 517 352 131 246 270
Base content (%) 48.3% 51.7%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 479 565 373 106 243 322
Base content per 1 kb (bases) 459 541 357 102 233 308
Base content (%) 45.9% 54.1%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 157 191 115 42 93 98
Base content per 1 kb (bases) 451 549 330 121 267 282
Base content (%) 45.1% 54.9%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 648 726 495 153 301 425
Base content per 1 kb (bases) 472 528 360 111 219 309
Base content (%) 47.2% 52.8%
ND4L (size: 294 bases) GC AT G C A T
Base content (bases) 149 145 118 31 79 66
Base content per 1 kb (bases) 507 493 401 105 269 224
Base content (%) 50.7% 49.3%
ND5 (size: 1809 bases) GC AT G C A T
Base content (bases) 853 956 655 198 375 581
Base content per 1 kb (bases) 472 528 362 109 207 321
Base content (%) 47.2% 52.8%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 262 260 218 44 51 209
Base content per 1 kb (bases) 502 498 418 84 98 400
Base content (%) 50.2% 49.8%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 27 (11.89%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 19 (8.37%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 3 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 15 10 1 21 30 2 4 8 0 0 3 3 1 0 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 0 10 6 0 0 4 1 2 1 7 10 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 15 0 0 6 2 0 0 4 0 3 0 1 1 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 1 0 1 5 0 0 0 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 89 77 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 70 36 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 104 105 11
ATP8 (size: 169 bases)
Amino acid sequence: MPQLSPEPWLTVLLTVWTFFIIILQPKIATLTATNNPTPHKPQTTKTWPWPWTQTY
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 12 (21.82%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 4 (7.27%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 0 1 0 5 0 0 3 1 0 2 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 2 0 0 0 0 0 0 1 5 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 5 0 0 0 0 0 0 1 1 0 1 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 0 3 0 0 0 0 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 20 23 8
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 23 12 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 23 23 6
COX1 (size: 1555 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.32%)
Alanine (Ala, A)
n = 38 (7.35%)
Serine (Ser, S)
n = 32 (6.19%)
Threonine (Thr, T)
n = 45 (8.7%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.58%)
Leucine (Leu, L)
n = 58 (11.22%)
Isoleucine (Ile, I)
n = 40 (7.74%)
Methionine (Met, M)
n = 29 (5.61%)
Proline (Pro, P)
n = 33 (6.38%)
Phenylalanine (Phe, F)
n = 45 (8.7%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 19 (3.68%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 18 (3.48%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 27 26 5 16 28 4 5 7 1 4 16 14 0 9 36
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 8 18 10 2 1 9 26 7 3 14 16 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 23 1 5 15 7 0 1 4 2 15 2 0 2 17 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 7 3 1 13 8 1 0 1 6 1 0 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
139 120 147 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 143 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 237 198 58
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 10 (4.39%)
Serine (Ser, S)
n = 17 (7.46%)
Threonine (Thr, T)
n = 23 (10.09%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 12 (5.26%)
Leucine (Leu, L)
n = 28 (12.28%)
Isoleucine (Ile, I)
n = 16 (7.02%)
Methionine (Met, M)
n = 15 (6.58%)
Proline (Pro, P)
n = 15 (6.58%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 12 (5.26%)
Asparagine (Asn, N)
n = 10 (4.39%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 11 (4.82%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 14 12 2 10 8 4 4 8 0 2 5 4 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 0 4 6 0 0 4 3 1 1 6 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 0 4 6 5 0 0 2 2 7 1 0 1 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 1 1 9 3 0 0 3 1 1 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 63 69 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 63 63 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 107 85 25
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 19 (7.31%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 15 (5.77%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 11 10 4 13 10 3 3 7 0 3 3 6 1 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 14 4 0 0 9 8 1 2 8 4 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 1 2 4 6 0 2 4 1 12 2 0 1 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 4 3 1 3 2 0 0 2 2 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 75 59 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 132 86 29
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 30 (7.89%)
Serine (Ser, S)
n = 26 (6.84%)
Threonine (Thr, T)
n = 28 (7.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (4.21%)
Leucine (Leu, L)
n = 66 (17.37%)
Isoleucine (Ile, I)
n = 26 (6.84%)
Methionine (Met, M)
n = 14 (3.68%)
Proline (Pro, P)
n = 28 (7.37%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 12 (3.16%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.95%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 13 (3.42%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 20 12 4 25 23 7 7 7 1 0 7 8 1 4 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 22 5 1 0 6 11 6 1 11 12 4 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 10 1 3 14 6 0 0 3 3 9 1 0 2 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 0 0 9 8 1 0 3 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 116 95 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 109 73 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 197 132 27
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.36%)
Alanine (Ala, A)
n = 28 (8.72%)
Serine (Ser, S)
n = 22 (6.85%)
Threonine (Thr, T)
n = 31 (9.66%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 14 (4.36%)
Leucine (Leu, L)
n = 69 (21.5%)
Isoleucine (Ile, I)
n = 19 (5.92%)
Methionine (Met, M)
n = 15 (4.67%)
Proline (Pro, P)
n = 26 (8.1%)
Phenylalanine (Phe, F)
n = 18 (5.61%)
Tyrosine (Tyr, Y)
n = 10 (3.12%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 5 (1.56%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 7 (2.18%)
Glutamine (Gln, Q)
n = 6 (1.87%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 10 11 10 19 25 6 9 4 2 1 9 3 1 8 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 1 16 11 0 1 6 5 2 1 12 12 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 0 0 9 9 0 0 4 1 9 2 0 1 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 2 0 5 7 0 0 2 5 0 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 102 83 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 103 49 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 135 129 37
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (2.31%)
Alanine (Ala, A)
n = 34 (9.8%)
Serine (Ser, S)
n = 34 (9.8%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 64 (18.44%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 22 (6.34%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 14 (4.03%)
Glutamine (Gln, Q)
n = 7 (2.02%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 17 18 9 20 21 4 9 7 0 1 5 3 2 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 3 13 16 2 0 3 4 1 2 11 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 17 0 3 20 8 0 0 3 0 9 1 1 0 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 1 0 0 13 2 1 2 2 0 1 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 90 125 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 128 56 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 155 141 34
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (2.31%)
Alanine (Ala, A)
n = 34 (9.8%)
Serine (Ser, S)
n = 34 (9.8%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 64 (18.44%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 22 (6.34%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 14 (4.03%)
Glutamine (Gln, Q)
n = 7 (2.02%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 17 18 9 20 21 4 9 7 0 1 5 3 2 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 3 13 16 2 0 3 4 1 2 11 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 17 0 3 20 8 0 0 3 0 9 1 1 0 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 1 0 0 13 2 1 2 2 0 1 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 90 125 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 128 56 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 155 141 34
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.94%)
Alanine (Ala, A)
n = 35 (7.66%)
Serine (Ser, S)
n = 38 (8.32%)
Threonine (Thr, T)
n = 67 (14.66%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 12 (2.63%)
Leucine (Leu, L)
n = 86 (18.82%)
Isoleucine (Ile, I)
n = 29 (6.35%)
Methionine (Met, M)
n = 31 (6.78%)
Proline (Pro, P)
n = 29 (6.35%)
Phenylalanine (Phe, F)
n = 16 (3.5%)
Tyrosine (Tyr, Y)
n = 12 (2.63%)
Tryptophan (Trp, W)
n = 10 (2.19%)
Aspartic acid (Asp, D)
n = 7 (1.53%)
Glutamic acid (Glu, E)
n = 5 (1.09%)
Asparagine (Asn, N)
n = 15 (3.28%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 11 (2.41%)
Lysine (Lys, K)
n = 9 (1.97%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 18 27 6 28 41 8 3 14 0 0 5 6 1 5 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 9 16 8 2 1 7 7 3 0 14 15 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 28 2 3 12 12 1 3 7 5 7 2 0 3 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 1 1 6 8 1 1 0 8 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 146 161 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 159 74 174
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 190 190 53
ND4L (size: 294 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.12%)
Alanine (Ala, A)
n = 8 (8.25%)
Serine (Ser, S)
n = 14 (14.43%)
Threonine (Thr, T)
n = 11 (11.34%)
Cysteine (Cys, C)
n = 4 (4.12%)
Valine (Val, V)
n = 1 (1.03%)
Leucine (Leu, L)
n = 23 (23.71%)
Isoleucine (Ile, I)
n = 7 (7.22%)
Methionine (Met, M)
n = 2 (2.06%)
Proline (Pro, P)
n = 3 (3.09%)
Phenylalanine (Phe, F)
n = 6 (6.19%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.06%)
Asparagine (Asn, N)
n = 3 (3.09%)
Glutamine (Gln, Q)
n = 2 (2.06%)
Histidine (His, H)
n = 5 (5.15%)
Lysine (Lys, K)
n = 1 (1.03%)
Arginine (Arg, R)
n = 1 (1.03%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 5 2 5 10 6 0 1 2 0 0 1 0 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 3 1 6 0 1 0 4 0 0 1 2 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 1 3 3 5 0 0 3 0 0 0 1 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 1 1 0 0 1 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
15 32 27 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 33 14 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 53 25 16
ND5 (size: 1809 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (3.49%)
Alanine (Ala, A)
n = 61 (10.13%)
Serine (Ser, S)
n = 42 (6.98%)
Threonine (Thr, T)
n = 67 (11.13%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 17 (2.82%)
Leucine (Leu, L)
n = 100 (16.61%)
Isoleucine (Ile, I)
n = 53 (8.8%)
Methionine (Met, M)
n = 29 (4.82%)
Proline (Pro, P)
n = 34 (5.65%)
Phenylalanine (Phe, F)
n = 32 (5.32%)
Tyrosine (Tyr, Y)
n = 13 (2.16%)
Tryptophan (Trp, W)
n = 10 (1.66%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 9 (1.5%)
Asparagine (Asn, N)
n = 30 (4.98%)
Glutamine (Gln, Q)
n = 14 (2.33%)
Histidine (His, H)
n = 19 (3.16%)
Lysine (Lys, K)
n = 30 (4.98%)
Arginine (Arg, R)
n = 6 (1.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 44 24 8 38 45 4 4 14 0 2 5 9 1 5 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 3 5 33 23 0 0 6 12 3 1 13 18 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
39 22 3 3 12 11 4 1 11 3 10 0 1 3 27 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 9 0 1 9 29 1 1 1 4 0 0 1 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
118 168 222 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 192 125 231
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 295 234 49
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (17.34%)
Alanine (Ala, A)
n = 9 (5.2%)
Serine (Ser, S)
n = 9 (5.2%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 9 (5.2%)
Valine (Val, V)
n = 36 (20.81%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 3 (1.73%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 2 (1.16%)
Tryptophan (Trp, W)
n = 8 (4.62%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 2 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 0 5 0 0 3 3 0 0 12 1 3 20 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 8 1 4 1 1 3 8 1 2 19 0 1 0 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 2 0 1 1 4 1 1 1 5 16 1 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 3 1 0 1 1 0 1 0 1 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 15 20 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 20 14 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
80 9 17 68
Total protein-coding genes (size: 11380 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 199 (5.25%)
Alanine (Ala, A)
n = 299 (7.89%)
Serine (Ser, S)
n = 273 (7.2%)
Threonine (Thr, T)
n = 389 (10.26%)
Cysteine (Cys, C)
n = 32 (0.84%)
Valine (Val, V)
n = 175 (4.62%)
Leucine (Leu, L)
n = 641 (16.91%)
Isoleucine (Ile, I)
n = 274 (7.23%)
Methionine (Met, M)
n = 192 (5.06%)
Proline (Pro, P)
n = 241 (6.36%)
Phenylalanine (Phe, F)
n = 224 (5.91%)
Tyrosine (Tyr, Y)
n = 103 (2.72%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 84 (2.22%)
Asparagine (Asn, N)
n = 129 (3.4%)
Glutamine (Gln, Q)
n = 87 (2.29%)
Histidine (His, H)
n = 112 (2.95%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 61 (1.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
79 195 159 64 206 251 46 54 81 6 25 62 59 29 57 167
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
33 15 17 35 159 94 11 12 61 81 45 15 109 105 12 29
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
188 162 10 28 105 76 6 11 47 19 84 17 20 15 114 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
101 66 18 8 60 89 7 4 14 40 3 2 1 4 2 87
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
825 1068 1141 758
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
457 1144 685 1506
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
266 1689 1410 427

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.