Viewing data for Bison bonasus


Scientific name Bison bonasus
Common name European bison
Maximum lifespan 26.40 years (Bison bonasus@AnAge)

Total mtDNA (size: 16326 bases) GC AT G C A T
Base content (bases) 6391 9935 4230 2161 4442 5493
Base content per 1 kb (bases) 391 609 259 132 272 336
Base content (%) 39.1% 60.9%
Total protein-coding genes (size: 11336 bases) GC AT G C A T
Base content (bases) 4479 6857 3122 1357 3153 3704
Base content per 1 kb (bases) 395 605 275 120 278 327
Base content (%) 39.5% 60.5%
D-loop (size: 898 bases) GC AT G C A T
Base content (bases) 351 547 225 126 260 287
Base content per 1 kb (bases) 391 609 251 140 290 320
Base content (%) 39.1% 60.9%
Total tRNA-coding genes (size: 1498 bases) GC AT G C A T
Base content (bases) 549 949 319 230 427 522
Base content per 1 kb (bases) 366 634 213 154 285 348
Base content (%) 36.6% 63.4%
Total rRNA-coding genes (size: 2527 bases) GC AT G C A T
Base content (bases) 981 1546 545 436 591 955
Base content per 1 kb (bases) 388 612 216 173 234 378
Base content (%) 38.8% 61.2%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 388 568 216 172 217 351
Base content per 1 kb (bases) 406 594 226 180 227 367
Base content (%) 40.6% 59.4%
16S rRNA gene (size: 1571 bases) GC AT G C A T
Base content (bases) 593 978 329 264 374 604
Base content per 1 kb (bases) 377 623 209 168 238 384
Base content (%) 37.7% 62.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 265 416 187 78 194 222
Base content per 1 kb (bases) 389 611 275 115 285 326
Base content (%) 38.9% 61.1%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 61 140 48 13 57 83
Base content per 1 kb (bases) 303 697 239 65 284 413
Base content (%) 30.3% 69.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 640 905 386 254 464 441
Base content per 1 kb (bases) 414 586 250 164 300 285
Base content (%) 41.4% 58.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 260 424 163 97 187 237
Base content per 1 kb (bases) 380 620 238 142 273 346
Base content (%) 38.0% 62.0%
COX3 (size: 781 bases) GC AT G C A T
Base content (bases) 343 438 224 119 233 205
Base content per 1 kb (bases) 439 561 287 152 298 262
Base content (%) 43.9% 56.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 481 659 333 148 295 364
Base content per 1 kb (bases) 422 578 292 130 259 319
Base content (%) 42.2% 57.8%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 390 566 274 116 257 309
Base content per 1 kb (bases) 408 592 287 121 269 323
Base content (%) 40.8% 59.2%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 370 672 285 85 285 387
Base content per 1 kb (bases) 355 645 274 82 274 371
Base content (%) 35.5% 64.5%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 140 207 100 40 96 111
Base content per 1 kb (bases) 403 597 288 115 277 320
Base content (%) 40.3% 59.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 531 847 382 149 401 446
Base content per 1 kb (bases) 385 615 277 108 291 324
Base content (%) 38.5% 61.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 106 191 71 35 96 95
Base content per 1 kb (bases) 357 643 239 118 323 320
Base content (%) 35.7% 64.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 717 1104 529 188 499 605
Base content per 1 kb (bases) 394 606 290 103 274 332
Base content (%) 39.4% 60.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 193 335 152 41 113 222
Base content per 1 kb (bases) 366 634 288 78 214 420
Base content (%) 36.6% 63.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 10 10 5 6 24 1 6 9 0 0 1 8 2 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 7 5 0 1 2 7 1 4 5 3 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 15 1 1 2 6 0 2 5 2 0 0 2 5 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 4 0 0 2 1 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 67 82 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 62 36 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 58 104 54
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLTLFIIFQLKISKHNFYYNPELTPTKMSKQNTPWEMKWTKIYLPLLLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 8 (12.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 12 (18.18%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 3 (4.55%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 4 1 1 3 1 4 3 0 0 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 1 2 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 2 0 0 4 0 0 0 1 2 0 2 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 16 27 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 18 20 26
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 14 36 10
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 17 26 6 9 25 0 18 6 0 10 10 17 1 18 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 9 13 17 1 9 9 23 6 9 10 8 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 16 3 8 5 14 0 0 3 6 13 2 1 9 10 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 0 7 9 5 4 0 2 5 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 99 140 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 154 205 128
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 6 13 6 0 17 2 9 6 0 2 4 6 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 2 1 4 1 1 3 3 1 1 4 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 12 1 4 3 9 0 1 4 5 6 0 0 2 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 10 5 6 4 2 4 2 0 3 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 57 68 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 51 108 51
COX3 (size: 781 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.72%)
Alanine (Ala, A)
n = 15 (5.79%)
Serine (Ser, S)
n = 18 (6.95%)
Threonine (Thr, T)
n = 25 (9.65%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.18%)
Leucine (Leu, L)
n = 31 (11.97%)
Isoleucine (Ile, I)
n = 14 (5.41%)
Methionine (Met, M)
n = 10 (3.86%)
Proline (Pro, P)
n = 12 (4.63%)
Phenylalanine (Phe, F)
n = 24 (9.27%)
Tyrosine (Tyr, Y)
n = 11 (4.25%)
Tryptophan (Trp, W)
n = 12 (4.63%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.09%)
Asparagine (Asn, N)
n = 6 (2.32%)
Glutamine (Gln, Q)
n = 7 (2.7%)
Histidine (His, H)
n = 17 (6.56%)
Lysine (Lys, K)
n = 3 (1.16%)
Arginine (Arg, R)
n = 5 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 7 4 5 9 3 9 7 0 4 8 4 0 12 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 10 2 0 0 11 8 1 4 3 5 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 1 4 6 4 0 0 4 7 4 1 1 1 5 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 1 2 2 2 1 1 1 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 62 62 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 96 87 64
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 29 (7.65%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 38 (10.03%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 24 (6.33%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 19 12 5 12 34 1 7 6 0 1 5 10 1 8 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 5 6 14 0 2 6 14 3 1 6 15 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 1 4 7 9 0 0 2 5 11 0 0 4 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 1 10 9 1 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 100 113 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 96 78 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 137 173 58
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.42%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 19 (5.99%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 12 (3.79%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 31 (9.78%)
Methionine (Met, M)
n = 22 (6.94%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 18 (5.68%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 22 18 5 8 32 3 6 6 0 1 2 8 1 11 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 3 10 16 0 2 6 6 0 3 8 10 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 15 0 2 7 11 1 1 1 5 7 0 2 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 2 1 7 0 0 1 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 87 93 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 91 54 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 96 161 48
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 21 39 5 7 32 4 5 8 1 0 5 6 0 5 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 8 4 0 1 4 8 1 4 6 11 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 0 7 3 15 0 1 0 4 4 0 0 5 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 86 151 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 102 59 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 97 177 63
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 21 39 5 7 32 4 5 8 1 0 5 6 0 5 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 8 4 0 1 4 8 1 4 6 11 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 0 7 3 15 0 1 0 4 4 0 0 5 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 86 151 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 102 59 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 97 177 63
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 33 (7.21%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 91 (19.87%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 38 (8.3%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 22 (4.8%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 17 32 13 12 49 5 12 9 2 2 4 8 1 13 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 5 10 14 0 1 7 8 2 6 7 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 2 6 11 11 0 2 9 7 9 2 0 10 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 0 0 4 11 0 1 1 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 133 158 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 111 85 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 138 203 98
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 12 2 3 11 2 3 2 0 1 1 5 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 3 5 0 2 0 2 0 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 5 2 2 0 0 1 4 0 0 0 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 24 28 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 23 50 23
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 44 (7.26%)
Serine (Ser, S)
n = 50 (8.25%)
Threonine (Thr, T)
n = 50 (8.25%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 14 (2.31%)
Leucine (Leu, L)
n = 86 (14.19%)
Isoleucine (Ile, I)
n = 64 (10.56%)
Methionine (Met, M)
n = 41 (6.77%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 24 (3.96%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 10 (1.65%)
Lysine (Lys, K)
n = 25 (4.13%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 32 38 7 21 41 3 12 15 2 3 5 5 1 16 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 2 4 20 20 0 4 12 12 0 2 13 9 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 26 1 10 11 16 0 2 11 7 17 0 2 10 24 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 1 1 10 25 0 0 5 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 133 227 139
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 157 133 252
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 239 245 108
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 16 (9.14%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 0 5 1 0 2 0 8 0 1 9 2 5 6 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 4 1 1 1 9 1 3 13 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 1 4 1 0 2 4 0 7 3 3 7 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 6 4 0 2 2 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 8 46 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 25 33 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 8 34 86
Total protein-coding genes (size: 11401 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 218 (5.74%)
Alanine (Ala, A)
n = 250 (6.58%)
Serine (Ser, S)
n = 276 (7.27%)
Threonine (Thr, T)
n = 307 (8.09%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 178 (4.69%)
Leucine (Leu, L)
n = 590 (15.54%)
Isoleucine (Ile, I)
n = 334 (8.8%)
Methionine (Met, M)
n = 268 (7.06%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 244 (6.43%)
Tyrosine (Tyr, Y)
n = 139 (3.66%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 162 (4.27%)
Glutamine (Gln, Q)
n = 86 (2.26%)
Histidine (His, H)
n = 92 (2.42%)
Lysine (Lys, K)
n = 101 (2.66%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
172 162 223 65 87 292 27 102 80 6 33 48 84 13 118 126
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
45 6 16 46 96 105 3 32 61 97 28 39 67 82 5 55
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
80 159 13 56 59 103 3 13 42 60 79 8 17 58 104 29
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 77 18 24 44 89 12 5 13 41 4 1 0 7 0 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
809 905 1228 856
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 971 750 1614
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
202 1147 1638 811

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.