Viewing data for Melamprosops phaeosoma


Scientific name Melamprosops phaeosoma
Common name Poo-uli
Maximum lifespan 9.20 years (Melamprosops phaeosoma@AnAge)

Total mtDNA (size: 16840 bases) GC AT G C A T
Base content (bases) 7635 9204 5228 2407 4076 5128
Base content per 1 kb (bases) 453 547 310 143 242 305
Base content (%) 45.3% 54.7%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5245 6132 3807 1438 2728 3404
Base content per 1 kb (bases) 461 539 335 126 240 299
Base content (%) 46.1% 53.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1542 bases) GC AT G C A T
Base content (bases) 637 905 366 271 403 502
Base content per 1 kb (bases) 413 587 237 176 261 326
Base content (%) 41.3% 58.7%
Total rRNA-coding genes (size: 2577 bases) GC AT G C A T
Base content (bases) 1170 1407 646 524 559 848
Base content per 1 kb (bases) 454 546 251 203 217 329
Base content (%) 45.4% 54.6%
12S rRNA gene (size: 978 bases) GC AT G C A T
Base content (bases) 472 506 266 206 206 300
Base content per 1 kb (bases) 483 517 272 211 211 307
Base content (%) 48.3% 51.7%
16S rRNA gene (size: 1599 bases) GC AT G C A T
Base content (bases) 698 901 380 318 353 548
Base content per 1 kb (bases) 437 563 238 199 221 343
Base content (%) 43.7% 56.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 305 379 241 64 166 213
Base content per 1 kb (bases) 446 554 352 94 243 311
Base content (%) 44.6% 55.4%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 68 100 57 11 50 50
Base content per 1 kb (bases) 405 595 339 65 298 298
Base content (%) 40.5% 59.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 742 808 487 255 379 429
Base content per 1 kb (bases) 478 521 314 164 244 277
Base content (%) 47.8% 52.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 313 371 212 101 162 209
Base content per 1 kb (bases) 458 542 310 148 237 306
Base content (%) 45.8% 54.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 372 412 252 120 196 216
Base content per 1 kb (bases) 474 526 321 153 250 276
Base content (%) 47.4% 52.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 530 613 379 151 285 328
Base content per 1 kb (bases) 464 536 332 132 249 287
Base content (%) 46.4% 53.6%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 451 527 309 142 263 264
Base content per 1 kb (bases) 461 539 316 145 269 270
Base content (%) 46.1% 53.9%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 462 578 352 110 263 315
Base content per 1 kb (bases) 444 556 338 106 253 303
Base content (%) 44.4% 55.6%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 146 205 109 37 99 106
Base content per 1 kb (bases) 416 584 311 105 282 302
Base content (%) 41.6% 58.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 639 739 488 151 314 425
Base content per 1 kb (bases) 464 536 354 110 228 308
Base content (%) 46.4% 53.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 140 157 104 36 74 83
Base content per 1 kb (bases) 471 529 350 121 249 279
Base content (%) 47.1% 52.9%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 829 989 618 211 420 569
Base content per 1 kb (bases) 456 544 340 116 231 313
Base content (%) 45.6% 54.4%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 253 266 202 51 61 205
Base content per 1 kb (bases) 487 513 389 98 118 395
Base content (%) 48.7% 51.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 17 6 5 13 36 2 5 8 0 1 3 3 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 9 3 1 0 5 3 0 1 4 10 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 1 2 4 5 1 0 4 0 3 0 0 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 1 2 4 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 87 69 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 89 109 23
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWLFIMIISWFTFSLIIQPKILTFVSMNPLSNKPPIAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 7 (12.73%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 1 2 1 2 0 0 2 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 1 0 0 0 0 0 5 2 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 2 1 1 0 0 1 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 17 22 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 22 8 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 18 20 16
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.14%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 23 (4.46%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 16 (3.1%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 27 19 5 14 35 6 3 9 0 2 18 21 1 7 36
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 8 25 12 0 11 9 24 2 4 8 18 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 17 2 4 9 11 0 0 4 0 17 0 0 3 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 11 0 1 15 8 0 1 2 5 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
160 126 125 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 225 210 65
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 23 (10.13%)
Threonine (Thr, T)
n = 14 (6.17%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 27 (11.89%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 13 11 4 7 12 2 2 6 0 3 5 8 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 6 7 4 1 0 1 6 1 4 2 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 1 3 10 5 0 0 5 1 6 0 0 0 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 0 8 5 4 0 1 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 58 59 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 62 58 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 92 92 36
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 13 6 1 6 21 2 2 7 1 4 3 8 0 4 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 4 11 9 0 2 7 11 0 4 4 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 0 6 2 5 0 0 4 0 10 0 0 0 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 1 0 5 4 0 2 1 2 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 72 56 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 70 53 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 110 107 38
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 29 (7.63%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 24 (6.32%)
Leucine (Leu, L)
n = 64 (16.84%)
Isoleucine (Ile, I)
n = 32 (8.42%)
Methionine (Met, M)
n = 6 (1.58%)
Proline (Pro, P)
n = 23 (6.05%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 21 5 7 13 39 2 3 7 1 4 7 12 1 3 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 5 15 7 2 2 8 12 2 4 8 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 14 1 5 6 11 0 0 1 0 12 0 0 2 19 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 0 2 6 9 1 2 2 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
92 112 96 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 100 79 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 167 153 50
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 26 (8.0%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 16 (4.92%)
Leucine (Leu, L)
n = 67 (20.62%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 14 (4.31%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 12 7 8 13 32 6 6 3 3 1 4 10 1 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 6 10 11 4 2 5 5 1 5 11 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 6 1 5 6 7 1 1 6 4 11 0 2 4 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 4 2 2 6 1 2 1 5 0 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 100 82 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 93 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 116 122 60
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 30 (8.7%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 38 (11.01%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.61%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 11 (3.19%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 20 13 5 23 23 6 8 11 0 0 6 3 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 11 11 2 3 4 5 1 5 5 10 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 10 1 9 6 10 2 0 5 1 6 1 1 2 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 14 0 0 2 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 101 121 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 115 59 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 136 134 57
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 30 (8.7%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 38 (11.01%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.61%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 11 (3.19%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 20 13 5 23 23 6 8 11 0 0 6 3 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 11 11 2 3 4 5 1 5 5 10 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 10 1 9 6 10 2 0 5 1 6 1 1 2 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 14 0 0 2 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 101 121 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 115 59 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 136 134 57
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 41 (8.95%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 35 22 5 29 49 7 8 12 2 0 7 6 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 4 22 15 0 2 7 9 0 6 11 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 17 0 6 6 16 0 0 8 3 11 0 0 2 15 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 2 1 1 10 0 0 1 9 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 155 142 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 137 80 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 196 203 45
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 4 0 4 15 0 0 3 0 0 0 2 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 2 5 2 0 0 3 1 0 1 0 2 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 0 5 5 0 2 2 0 3 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 1 1 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 33 25 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 42 40 13
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 49 (8.1%)
Serine (Ser, S)
n = 56 (9.26%)
Threonine (Thr, T)
n = 66 (10.91%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 98 (16.2%)
Isoleucine (Ile, I)
n = 55 (9.09%)
Methionine (Met, M)
n = 30 (4.96%)
Proline (Pro, P)
n = 30 (4.96%)
Phenylalanine (Phe, F)
n = 37 (6.12%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 26 (4.3%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 46 23 6 19 60 6 7 17 0 2 5 9 1 8 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 6 7 27 13 2 2 8 21 2 6 15 9 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 23 0 6 18 20 0 0 12 0 13 0 0 4 22 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 12 0 1 8 19 1 1 2 5 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
120 157 210 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 189 108 237
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 272 251 64
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (18.02%)
Alanine (Ala, A)
n = 13 (7.56%)
Serine (Ser, S)
n = 16 (9.3%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 31 (18.02%)
Leucine (Leu, L)
n = 29 (16.86%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 11 (6.4%)
Tyrosine (Tyr, Y)
n = 6 (3.49%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 5 (2.91%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 3 4 0 1 2 8 0 0 15 1 2 13 11 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 5 1 1 6 6 0 9 16 2 0 0 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 7 0 0 4 3 2 5 1 3 14 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 5 1 1 0 0 0 0 1 3 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 15 19 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 30 16 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 6 26 67
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 224 (5.9%)
Alanine (Ala, A)
n = 311 (8.19%)
Serine (Ser, S)
n = 298 (7.85%)
Threonine (Thr, T)
n = 308 (8.11%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 194 (5.11%)
Leucine (Leu, L)
n = 660 (17.39%)
Isoleucine (Ile, I)
n = 299 (7.88%)
Methionine (Met, M)
n = 163 (4.29%)
Proline (Pro, P)
n = 219 (5.77%)
Phenylalanine (Phe, F)
n = 225 (5.93%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 67 (1.77%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 134 (3.53%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 100 (2.63%)
Lysine (Lys, K)
n = 84 (2.21%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
79 220 124 56 147 344 41 55 88 7 32 59 86 17 54 171
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
39 5 22 57 146 90 18 30 57 111 25 48 72 97 2 51
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
128 121 8 55 76 98 8 6 55 15 94 4 17 21 113 13
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
87 78 14 18 49 81 3 9 14 44 5 2 1 6 1 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
887 1074 1052 783
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
492 1075 688 1541
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
210 1510 1527 549

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.