Viewing data for Lampetra fluviatilis


Scientific name Lampetra fluviatilis
Common name Lamprey
Maximum lifespan 10.00 years (Lampetra fluviatilis@AnAge)

Total mtDNA (size: 16159 bases) GC AT G C A T
Base content (bases) 6240 9919 3943 2297 4795 5124
Base content per 1 kb (bases) 386 614 244 142 297 317
Base content (%) 38.6% 61.4%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 4353 7026 2863 1490 3492 3534
Base content per 1 kb (bases) 383 617 252 131 307 311
Base content (%) 38.3% 61.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1524 bases) GC AT G C A T
Base content (bases) 605 919 341 264 425 494
Base content per 1 kb (bases) 397 603 224 173 279 324
Base content (%) 39.7% 60.3%
Total rRNA-coding genes (size: 2519 bases) GC AT G C A T
Base content (bases) 1034 1485 578 456 599 886
Base content per 1 kb (bases) 410 590 229 181 238 352
Base content (%) 41.0% 59.0%
12S rRNA gene (size: 903 bases) GC AT G C A T
Base content (bases) 412 491 240 172 197 294
Base content per 1 kb (bases) 456 544 266 190 218 326
Base content (%) 45.6% 54.4%
16S rRNA gene (size: 1616 bases) GC AT G C A T
Base content (bases) 622 994 338 284 402 592
Base content per 1 kb (bases) 385 615 209 176 249 366
Base content (%) 38.5% 61.5%

ATP6 (size: 679 bases) GC AT G C A T
Base content (bases) 242 437 178 64 218 219
Base content per 1 kb (bases) 356 644 262 94 321 323
Base content (%) 35.6% 64.4%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 63 105 48 15 48 57
Base content per 1 kb (bases) 375 625 286 89 286 339
Base content (%) 37.5% 62.5%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 624 930 375 249 491 439
Base content per 1 kb (bases) 402 598 241 160 316 282
Base content (%) 40.2% 59.8%
COX2 (size: 690 bases) GC AT G C A T
Base content (bases) 262 428 162 100 208 220
Base content per 1 kb (bases) 380 620 235 145 301 319
Base content (%) 38.0% 62.0%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 335 451 210 125 235 216
Base content per 1 kb (bases) 426 574 267 159 299 275
Base content (%) 42.6% 57.4%
CYTB (size: 1191 bases) GC AT G C A T
Base content (bases) 452 739 279 173 401 338
Base content per 1 kb (bases) 380 620 234 145 337 284
Base content (%) 38.0% 62.0%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 373 593 233 140 312 281
Base content per 1 kb (bases) 386 614 241 145 323 291
Base content (%) 38.6% 61.4%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 379 665 254 125 329 336
Base content per 1 kb (bases) 363 637 243 120 315 322
Base content (%) 36.3% 63.7%
ND3 (size: 350 bases) GC AT G C A T
Base content (bases) 137 213 92 45 120 93
Base content per 1 kb (bases) 391 609 263 129 343 266
Base content (%) 39.1% 60.9%
ND4 (size: 1377 bases) GC AT G C A T
Base content (bases) 512 865 359 153 445 420
Base content per 1 kb (bases) 372 628 261 111 323 305
Base content (%) 37.2% 62.8%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 112 179 79 33 90 89
Base content per 1 kb (bases) 385 615 271 113 309 306
Base content (%) 38.5% 61.5%
ND5 (size: 1797 bases) GC AT G C A T
Base content (bases) 680 1117 467 213 526 591
Base content per 1 kb (bases) 378 622 260 119 293 329
Base content (%) 37.8% 62.2%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 198 321 136 62 76 245
Base content per 1 kb (bases) 382 618 262 119 146 472
Base content (%) 38.2% 61.8%

ATP6 (size: 679 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.56%)
Alanine (Ala, A)
n = 18 (8.0%)
Serine (Ser, S)
n = 10 (4.44%)
Threonine (Thr, T)
n = 25 (11.11%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 8 (3.56%)
Leucine (Leu, L)
n = 49 (21.78%)
Isoleucine (Ile, I)
n = 25 (11.11%)
Methionine (Met, M)
n = 15 (6.67%)
Proline (Pro, P)
n = 15 (6.67%)
Phenylalanine (Phe, F)
n = 10 (4.44%)
Tyrosine (Tyr, Y)
n = 5 (2.22%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.22%)
Asparagine (Asn, N)
n = 6 (2.67%)
Glutamine (Gln, Q)
n = 9 (4.0%)
Histidine (His, H)
n = 4 (1.78%)
Lysine (Lys, K)
n = 6 (2.67%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 13 13 11 3 17 1 17 9 0 3 3 2 0 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 7 6 5 0 0 2 3 3 7 0 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 1 3 1 4 0 1 1 2 3 0 0 3 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 0 1 6 0 0 1 2 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 63 79 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 66 36 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 49 104 66
ATP8 (size: 168 bases)
Amino acid sequence: MPQLEPAPWFSMLTVSWLIILLLIMPTIMFYQTQNTVSAQQATKPKQPTWTWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 1 (1.82%)
Glutamine (Gln, Q)
n = 6 (10.91%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 2 2 0 1 0 3 6 0 0 1 1 0 2 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 1 0 0 0 0 0 0 1 3 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 2 0 1 0 0 0 0 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 1 0 0 2 0 0 0 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 17 18 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 20 13 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 11 26 15
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.51%)
Alanine (Ala, A)
n = 44 (8.51%)
Serine (Ser, S)
n = 30 (5.8%)
Threonine (Thr, T)
n = 39 (7.54%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.54%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 40 (7.74%)
Methionine (Met, M)
n = 27 (5.22%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 17 (3.29%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 11 (2.13%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 16 24 17 6 19 0 19 7 0 17 5 15 2 21 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 11 20 12 1 3 10 23 8 5 6 17 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 17 3 6 7 12 0 1 4 9 10 1 1 8 9 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 0 8 7 9 2 4 1 2 1 1 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 104 140 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 136 97 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 135 202 159
COX2 (size: 690 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 12 (5.24%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 19 (8.3%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 17 (7.42%)
Leucine (Leu, L)
n = 25 (10.92%)
Isoleucine (Ile, I)
n = 23 (10.04%)
Methionine (Met, M)
n = 9 (3.93%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 9 (3.93%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 7 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 10 7 8 2 8 1 6 7 2 5 2 10 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 3 2 7 0 3 2 4 0 3 0 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 7 1 4 6 3 0 4 0 5 4 0 0 5 0 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 13 2 7 5 3 0 0 4 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 57 63 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 57 63 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 48 94 80
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.28%)
Alanine (Ala, A)
n = 23 (8.81%)
Serine (Ser, S)
n = 16 (6.13%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.51%)
Leucine (Leu, L)
n = 35 (13.41%)
Isoleucine (Ile, I)
n = 11 (4.21%)
Methionine (Met, M)
n = 12 (4.6%)
Proline (Pro, P)
n = 11 (4.21%)
Phenylalanine (Phe, F)
n = 20 (7.66%)
Tyrosine (Tyr, Y)
n = 13 (4.98%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 4 (1.53%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 5 10 8 0 15 5 5 7 0 7 2 8 0 10 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 7 8 8 0 4 11 4 0 1 2 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 0 5 5 1 1 1 3 7 6 0 2 2 2 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 1 2 2 3 0 0 1 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 67 56 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 68 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 75 103 73
CYTB (size: 1191 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.57%)
Alanine (Ala, A)
n = 30 (7.58%)
Serine (Ser, S)
n = 25 (6.31%)
Threonine (Thr, T)
n = 24 (6.06%)
Cysteine (Cys, C)
n = 4 (1.01%)
Valine (Val, V)
n = 18 (4.55%)
Leucine (Leu, L)
n = 55 (13.89%)
Isoleucine (Ile, I)
n = 41 (10.35%)
Methionine (Met, M)
n = 16 (4.04%)
Proline (Pro, P)
n = 23 (5.81%)
Phenylalanine (Phe, F)
n = 31 (7.83%)
Tyrosine (Tyr, Y)
n = 14 (3.54%)
Tryptophan (Trp, W)
n = 12 (3.03%)
Aspartic acid (Asp, D)
n = 8 (2.02%)
Glutamic acid (Glu, E)
n = 7 (1.77%)
Asparagine (Asn, N)
n = 22 (5.56%)
Glutamine (Gln, Q)
n = 8 (2.02%)
Histidine (His, H)
n = 13 (3.28%)
Lysine (Lys, K)
n = 10 (2.53%)
Arginine (Arg, R)
n = 9 (2.27%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 11 14 11 5 15 4 18 8 0 10 2 5 1 19 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 4 0 7 10 10 3 4 7 7 8 6 3 13 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 10 2 9 0 2 2 8 6 2 2 10 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 1 5 3 7 3 2 1 5 1 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
89 88 118 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 98 82 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 93 138 138
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (6.23%)
Alanine (Ala, A)
n = 30 (9.35%)
Serine (Ser, S)
n = 24 (7.48%)
Threonine (Thr, T)
n = 20 (6.23%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 19 (5.92%)
Leucine (Leu, L)
n = 61 (19.0%)
Isoleucine (Ile, I)
n = 23 (7.17%)
Methionine (Met, M)
n = 17 (5.3%)
Proline (Pro, P)
n = 18 (5.61%)
Phenylalanine (Phe, F)
n = 20 (6.23%)
Tyrosine (Tyr, Y)
n = 9 (2.8%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 13 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.8%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 7 15 15 6 16 4 19 8 1 5 4 9 1 15 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 5 10 13 2 4 2 12 2 3 6 8 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 5 1 4 6 9 2 0 3 6 3 0 1 9 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 1 2 1 6 1 0 1 6 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 77 83 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 89 54 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 67 144 92
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 30 (8.65%)
Serine (Ser, S)
n = 25 (7.2%)
Threonine (Thr, T)
n = 37 (10.66%)
Cysteine (Cys, C)
n = 4 (1.15%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 61 (17.58%)
Isoleucine (Ile, I)
n = 33 (9.51%)
Methionine (Met, M)
n = 23 (6.63%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 10 19 19 5 16 1 19 11 1 5 0 2 2 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 2 12 6 11 1 5 9 3 1 3 3 12 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 20 0 4 1 12 0 2 6 3 4 2 1 12 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 2 1 8 2 2 1 1 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 82 129 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 103 61 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 69 146 116
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.19%)
Alanine (Ala, A)
n = 30 (8.65%)
Serine (Ser, S)
n = 25 (7.2%)
Threonine (Thr, T)
n = 37 (10.66%)
Cysteine (Cys, C)
n = 4 (1.15%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 61 (17.58%)
Isoleucine (Ile, I)
n = 33 (9.51%)
Methionine (Met, M)
n = 23 (6.63%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 10 19 19 5 16 1 19 11 1 5 0 2 2 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 2 12 6 11 1 5 9 3 1 3 3 12 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 20 0 4 1 12 0 2 6 3 4 2 1 12 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 2 1 8 2 2 1 1 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 82 129 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 103 61 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 69 146 116
ND4 (size: 1377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.28%)
Alanine (Ala, A)
n = 34 (7.42%)
Serine (Ser, S)
n = 41 (8.95%)
Threonine (Thr, T)
n = 42 (9.17%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 80 (17.47%)
Isoleucine (Ile, I)
n = 47 (10.26%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 25 (5.46%)
Phenylalanine (Phe, F)
n = 25 (5.46%)
Tyrosine (Tyr, Y)
n = 8 (1.75%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 9 (1.97%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 16 29 18 10 25 1 21 8 1 3 4 2 2 16 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 3 13 13 8 0 1 7 6 1 6 8 11 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 0 9 4 16 1 2 9 6 2 0 5 8 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 3 1 4 12 0 2 2 4 1 1 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 110 165 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 131 73 199
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 118 182 137
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 12 (12.5%)
Serine (Ser, S)
n = 8 (8.33%)
Threonine (Thr, T)
n = 9 (9.38%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 1 (1.04%)
Leucine (Leu, L)
n = 26 (27.08%)
Isoleucine (Ile, I)
n = 4 (4.17%)
Methionine (Met, M)
n = 6 (6.25%)
Proline (Pro, P)
n = 3 (3.13%)
Phenylalanine (Phe, F)
n = 4 (4.17%)
Tyrosine (Tyr, Y)
n = 1 (1.04%)
Tryptophan (Trp, W)
n = 1 (1.04%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 4 (4.17%)
Glutamine (Gln, Q)
n = 2 (2.08%)
Histidine (His, H)
n = 2 (2.08%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 2 (2.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 4 6 0 10 2 8 2 0 0 1 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 2 5 5 0 0 2 1 0 0 1 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 1 4 1 2 0 0 1 1 0 0 0 2 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 3 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 27 27 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 31 16 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 21 46 25
ND5 (size: 1797 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (4.01%)
Alanine (Ala, A)
n = 46 (7.69%)
Serine (Ser, S)
n = 48 (8.03%)
Threonine (Thr, T)
n = 57 (9.53%)
Cysteine (Cys, C)
n = 7 (1.17%)
Valine (Val, V)
n = 18 (3.01%)
Leucine (Leu, L)
n = 92 (15.38%)
Isoleucine (Ile, I)
n = 56 (9.36%)
Methionine (Met, M)
n = 38 (6.35%)
Proline (Pro, P)
n = 29 (4.85%)
Phenylalanine (Phe, F)
n = 34 (5.69%)
Tyrosine (Tyr, Y)
n = 13 (2.17%)
Tryptophan (Trp, W)
n = 14 (2.34%)
Aspartic acid (Asp, D)
n = 10 (1.67%)
Glutamic acid (Glu, E)
n = 14 (2.34%)
Asparagine (Asn, N)
n = 30 (5.02%)
Glutamine (Gln, Q)
n = 18 (3.01%)
Histidine (His, H)
n = 12 (2.01%)
Lysine (Lys, K)
n = 26 (4.35%)
Arginine (Arg, R)
n = 12 (2.01%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
42 14 34 20 9 37 6 19 16 2 6 2 10 0 18 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 4 9 23 13 1 3 6 13 2 4 9 14 2 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 23 2 11 10 11 1 9 6 7 6 2 1 14 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 3 2 8 26 0 2 3 6 1 0 1 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
112 143 223 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 165 123 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 159 245 167
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (11.05%)
Alanine (Ala, A)
n = 14 (8.14%)
Serine (Ser, S)
n = 9 (5.23%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 7 (4.07%)
Valine (Val, V)
n = 28 (16.28%)
Leucine (Leu, L)
n = 30 (17.44%)
Isoleucine (Ile, I)
n = 6 (3.49%)
Methionine (Met, M)
n = 6 (3.49%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 19 (11.05%)
Tyrosine (Tyr, Y)
n = 9 (5.23%)
Tryptophan (Trp, W)
n = 3 (1.74%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 3 3 0 1 3 17 0 0 17 3 5 3 18 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 6 1 9 4 1 0 5 2 2 10 3 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 5 0 0 1 1 2 7 2 1 6 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 3 0 0 0 2 0 1 1 1 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 16 23 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 28 19 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 18 34 89
Total protein-coding genes (size: 11412 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 210 (5.52%)
Alanine (Ala, A)
n = 304 (8.0%)
Serine (Ser, S)
n = 266 (7.0%)
Threonine (Thr, T)
n = 311 (8.18%)
Cysteine (Cys, C)
n = 38 (1.0%)
Valine (Val, V)
n = 190 (5.0%)
Leucine (Leu, L)
n = 610 (16.04%)
Isoleucine (Ile, I)
n = 321 (8.44%)
Methionine (Met, M)
n = 213 (5.6%)
Proline (Pro, P)
n = 203 (5.34%)
Phenylalanine (Phe, F)
n = 238 (6.26%)
Tyrosine (Tyr, Y)
n = 110 (2.89%)
Tryptophan (Trp, W)
n = 109 (2.87%)
Aspartic acid (Asp, D)
n = 69 (1.81%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 141 (3.71%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 99 (2.6%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 72 (1.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
217 104 177 147 47 191 29 177 91 7 79 30 70 11 147 91
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
36 22 16 90 110 96 8 32 62 81 35 43 43 110 7 91
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
81 129 10 71 47 80 7 24 37 62 48 8 19 76 65 41
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
58 80 15 35 34 87 8 15 16 36 5 4 1 4 2 101
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
868 886 1147 902
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
495 1023 713 1572
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
208 889 1514 1192

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.