Viewing data for Caretta caretta


Scientific name Caretta caretta
Common name Loggerhead sea turtle
Maximum lifespan 37.00 years (Caretta caretta@AnAge)

Total mtDNA (size: 16737 bases) GC AT G C A T
Base content (bases) 6441 10196 4451 1990 4310 5886
Base content per 1 kb (bases) 385 609 266 119 258 352
Base content (%) 38.5% 60.9%
Total protein-coding genes (size: 11347 bases) GC AT G C A T
Base content (bases) 4499 6848 3293 1206 2919 3929
Base content per 1 kb (bases) 396 604 290 106 257 346
Base content (%) 39.6% 60.4%
D-loop (size: 1234 bases) GC AT G C A T
Base content (bases) 316 818 198 118 415 403
Base content per 1 kb (bases) 256 663 160 96 336 327
Base content (%) 25.6% 66.3%
Total tRNA-coding genes (size: 1546 bases) GC AT G C A T
Base content (bases) 609 937 369 240 387 550
Base content per 1 kb (bases) 394 606 239 155 250 356
Base content (%) 39.4% 60.6%
Total rRNA-coding genes (size: 2581 bases) GC AT G C A T
Base content (bases) 1006 1575 582 424 579 996
Base content per 1 kb (bases) 390 610 225 164 224 386
Base content (%) 39.0% 61.0%
12S rRNA gene (size: 970 bases) GC AT G C A T
Base content (bases) 404 566 241 163 205 361
Base content per 1 kb (bases) 416 584 248 168 211 372
Base content (%) 41.6% 58.4%
16S rRNA gene (size: 1611 bases) GC AT G C A T
Base content (bases) 602 1009 341 261 374 635
Base content per 1 kb (bases) 374 626 212 162 232 394
Base content (%) 37.4% 62.6%

ATP6 (size: 682 bases) GC AT G C A T
Base content (bases) 257 425 204 53 186 239
Base content per 1 kb (bases) 377 623 299 78 273 350
Base content (%) 37.7% 62.3%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 59 106 51 8 38 68
Base content per 1 kb (bases) 358 642 309 48 230 412
Base content (%) 35.8% 64.2%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 644 904 407 237 436 468
Base content per 1 kb (bases) 416 584 263 153 282 302
Base content (%) 41.6% 58.4%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 255 432 170 85 182 250
Base content per 1 kb (bases) 371 629 247 124 265 364
Base content (%) 37.1% 62.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 328 456 215 113 208 248
Base content per 1 kb (bases) 418 582 274 144 265 316
Base content (%) 41.8% 58.2%
CYTB (size: 1144 bases) GC AT G C A T
Base content (bases) 496 648 369 127 279 369
Base content per 1 kb (bases) 434 566 323 111 244 323
Base content (%) 43.4% 56.6%
ND1 (size: 967 bases) GC AT G C A T
Base content (bases) 386 581 284 102 262 319
Base content per 1 kb (bases) 399 601 294 105 271 330
Base content (%) 39.9% 60.1%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 404 638 322 82 249 389
Base content per 1 kb (bases) 388 612 309 79 239 373
Base content (%) 38.8% 61.2%
ND3 (size: 350 bases) GC AT G C A T
Base content (bases) 134 216 99 35 101 115
Base content per 1 kb (bases) 383 617 283 100 289 329
Base content (%) 38.3% 61.7%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 506 875 378 128 377 498
Base content per 1 kb (bases) 366 634 274 93 273 361
Base content (%) 36.6% 63.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 117 180 89 28 86 94
Base content per 1 kb (bases) 394 606 300 94 290 316
Base content (%) 39.4% 60.6%
ND5 (size: 1797 bases) GC AT G C A T
Base content (bases) 719 1078 548 171 439 639
Base content per 1 kb (bases) 400 600 305 95 244 356
Base content (%) 40.0% 60.0%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 201 324 162 39 81 243
Base content per 1 kb (bases) 383 617 309 74 154 463
Base content (%) 38.3% 61.7%

ATP6 (size: 682 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 10 (4.42%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 33 (14.6%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.1%)
Leucine (Leu, L)
n = 57 (25.22%)
Isoleucine (Ile, I)
n = 19 (8.41%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 8 (3.54%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 4 (1.77%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 11 (4.87%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 10 12 9 5 25 0 18 11 0 2 0 5 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 7 1 0 0 4 5 0 3 1 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 15 0 0 2 8 0 0 3 1 2 0 0 3 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 2 0 1 0 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
31 73 80 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 68 34 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 63 125 38
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWLMILLSAWLIYTIILQPKISSYLPTNNPTNKNNKTNTNPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.85%)
Serine (Ser, S)
n = 3 (5.56%)
Threonine (Thr, T)
n = 7 (12.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.96%)
Isoleucine (Ile, I)
n = 5 (9.26%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 8 (14.81%)
Phenylalanine (Phe, F)
n = 0 (0%)
Tyrosine (Tyr, Y)
n = 2 (3.7%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 9 (16.67%)
Glutamine (Gln, Q)
n = 2 (3.7%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.56%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 1 1 1 2 0 3 2 0 0 0 0 0 0 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 2 1 4 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 1 1 1 0 0 0 0 2 0 0 3 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 14 26 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 19 17 14
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 18 25 10
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 42 (8.16%)
Serine (Ser, S)
n = 33 (6.41%)
Threonine (Thr, T)
n = 40 (7.77%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.18%)
Leucine (Leu, L)
n = 58 (11.26%)
Isoleucine (Ile, I)
n = 39 (7.57%)
Methionine (Met, M)
n = 31 (6.02%)
Proline (Pro, P)
n = 26 (5.05%)
Phenylalanine (Phe, F)
n = 40 (7.77%)
Tyrosine (Tyr, Y)
n = 19 (3.69%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.72%)
Glutamine (Gln, Q)
n = 9 (1.75%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 21 31 7 8 27 0 16 9 0 8 3 22 4 12 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 1 10 14 18 0 9 13 22 3 6 5 15 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 19 0 6 8 15 0 0 4 7 12 0 0 3 11 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 0 10 5 9 0 2 2 4 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 105 138 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 96 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 165 234 109
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 11 (4.82%)
Serine (Ser, S)
n = 15 (6.58%)
Threonine (Thr, T)
n = 17 (7.46%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.14%)
Leucine (Leu, L)
n = 28 (12.28%)
Isoleucine (Ile, I)
n = 20 (8.77%)
Methionine (Met, M)
n = 17 (7.46%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 8 (3.51%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 11 (4.82%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 9 15 4 3 9 0 12 7 0 0 2 12 0 2 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 3 2 6 0 0 1 7 0 0 2 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 0 2 2 8 1 0 2 3 5 1 0 3 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 1 4 6 3 0 0 1 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 54 67 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 55 62 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 61 121 42
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 27 (10.38%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 9 10 1 4 16 0 11 8 0 4 2 7 1 11 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 3 9 9 0 1 6 12 1 2 2 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 0 0 1 9 0 1 2 3 8 0 0 1 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 1 2 2 2 0 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 62 63 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 71 53 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 82 132 43
CYTB (size: 1144 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 22 (5.79%)
Serine (Ser, S)
n = 26 (6.84%)
Threonine (Thr, T)
n = 32 (8.42%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 13 (3.42%)
Leucine (Leu, L)
n = 66 (17.37%)
Isoleucine (Ile, I)
n = 34 (8.95%)
Methionine (Met, M)
n = 15 (3.95%)
Proline (Pro, P)
n = 23 (6.05%)
Phenylalanine (Phe, F)
n = 25 (6.58%)
Tyrosine (Tyr, Y)
n = 15 (3.95%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 10 (2.63%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 19 (5.0%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 11 (2.89%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 27 13 6 7 41 0 12 8 0 0 3 10 0 3 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 12 6 1 3 6 15 1 1 7 15 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 10 0 2 9 13 0 0 2 2 13 0 0 2 17 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 2 8 11 0 0 1 7 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 104 113 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 101 79 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 164 177 36
ND1 (size: 967 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.3%)
Alanine (Ala, A)
n = 20 (6.23%)
Serine (Ser, S)
n = 29 (9.03%)
Threonine (Thr, T)
n = 20 (6.23%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.74%)
Leucine (Leu, L)
n = 59 (18.38%)
Isoleucine (Ile, I)
n = 20 (6.23%)
Methionine (Met, M)
n = 25 (7.79%)
Proline (Pro, P)
n = 23 (7.17%)
Phenylalanine (Phe, F)
n = 22 (6.85%)
Tyrosine (Tyr, Y)
n = 14 (4.36%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 11 (3.43%)
Asparagine (Asn, N)
n = 14 (4.36%)
Glutamine (Gln, Q)
n = 6 (1.87%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 8 (2.49%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 10 24 2 7 40 3 7 6 0 4 2 6 0 6 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 13 6 0 1 6 10 0 1 4 18 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 6 0 1 12 15 0 0 1 8 6 0 0 3 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 11 0 1 3 8 0 0 0 7 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 90 88 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 91 59 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 103 172 43
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 26 (7.51%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 49 (14.16%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 1 (0.29%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 30 (8.67%)
Methionine (Met, M)
n = 31 (8.96%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 10 (2.89%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 14 (4.05%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 18 29 6 8 37 1 11 14 0 0 0 1 0 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 14 7 0 0 3 8 1 0 7 13 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 21 1 1 9 12 0 1 3 2 7 1 0 7 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 1 14 0 0 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 97 142 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 117 63 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 108 184 49
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 26 (7.51%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 49 (14.16%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 1 (0.29%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 30 (8.67%)
Methionine (Met, M)
n = 31 (8.96%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 10 (2.89%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 14 (4.05%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 18 29 6 8 37 1 11 14 0 0 0 1 0 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 14 7 0 0 3 8 1 0 7 13 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 21 1 1 9 12 0 1 3 2 7 1 0 7 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 1 14 0 0 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 97 142 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 117 63 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 108 184 49
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.14%)
Alanine (Ala, A)
n = 27 (5.88%)
Serine (Ser, S)
n = 39 (8.5%)
Threonine (Thr, T)
n = 56 (12.2%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 6 (1.31%)
Leucine (Leu, L)
n = 85 (18.52%)
Isoleucine (Ile, I)
n = 41 (8.93%)
Methionine (Met, M)
n = 35 (7.63%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 15 (3.27%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 17 (3.7%)
Glutamine (Gln, Q)
n = 13 (2.83%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 12 (2.61%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 24 33 9 6 49 1 19 13 0 0 1 5 0 11 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 11 7 9 0 3 6 9 1 7 3 16 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 27 0 4 7 19 0 1 8 4 10 0 1 7 10 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 12 0 1 1 12 0 0 1 9 0 0 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 125 170 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 139 81 183
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 114 247 94
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 5 (5.1%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 8 2 1 10 0 8 5 0 0 0 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 2 2 2 0 1 3 0 0 0 1 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 0 1 4 6 0 0 3 1 0 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
14 29 27 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 28 17 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 32 50 16
ND5 (size: 1797 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.68%)
Alanine (Ala, A)
n = 39 (6.52%)
Serine (Ser, S)
n = 48 (8.03%)
Threonine (Thr, T)
n = 74 (12.37%)
Cysteine (Cys, C)
n = 5 (0.84%)
Valine (Val, V)
n = 16 (2.68%)
Leucine (Leu, L)
n = 88 (14.72%)
Isoleucine (Ile, I)
n = 62 (10.37%)
Methionine (Met, M)
n = 34 (5.69%)
Proline (Pro, P)
n = 28 (4.68%)
Phenylalanine (Phe, F)
n = 35 (5.85%)
Tyrosine (Tyr, Y)
n = 16 (2.68%)
Tryptophan (Trp, W)
n = 12 (2.01%)
Aspartic acid (Asp, D)
n = 8 (1.34%)
Glutamic acid (Glu, E)
n = 11 (1.84%)
Asparagine (Asn, N)
n = 32 (5.35%)
Glutamine (Gln, Q)
n = 16 (2.68%)
Histidine (His, H)
n = 14 (2.34%)
Lysine (Lys, K)
n = 24 (4.01%)
Arginine (Arg, R)
n = 8 (1.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 42 32 5 16 54 0 13 15 1 3 3 9 1 12 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 5 5 19 14 1 2 11 15 0 2 6 20 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 36 1 2 14 23 0 1 8 5 11 0 0 8 24 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 0 2 6 23 1 2 2 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 141 235 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 180 122 235
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 227 282 83
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.37%)
Alanine (Ala, A)
n = 10 (5.75%)
Serine (Ser, S)
n = 14 (8.05%)
Threonine (Thr, T)
n = 2 (1.15%)
Cysteine (Cys, C)
n = 4 (2.3%)
Valine (Val, V)
n = 24 (13.79%)
Leucine (Leu, L)
n = 25 (14.37%)
Isoleucine (Ile, I)
n = 7 (4.02%)
Methionine (Met, M)
n = 9 (5.17%)
Proline (Pro, P)
n = 5 (2.87%)
Phenylalanine (Phe, F)
n = 16 (9.2%)
Tyrosine (Tyr, Y)
n = 13 (7.47%)
Tryptophan (Trp, W)
n = 7 (4.02%)
Aspartic acid (Asp, D)
n = 2 (1.15%)
Glutamic acid (Glu, E)
n = 4 (2.3%)
Asparagine (Asn, N)
n = 2 (1.15%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 0 3 3 0 0 1 12 0 0 14 0 3 7 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 4 0 5 0 3 2 11 0 1 13 2 0 1 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 5 1 1 0 7 0 13 0 4 9 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 2 2 0 0 0 3 0 2 0 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 14 28 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 24 21 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 1 32 94
Total protein-coding genes (size: 11368 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 218 (5.76%)
Alanine (Ala, A)
n = 241 (6.37%)
Serine (Ser, S)
n = 282 (7.45%)
Threonine (Thr, T)
n = 375 (9.9%)
Cysteine (Cys, C)
n = 26 (0.69%)
Valine (Val, V)
n = 146 (3.86%)
Leucine (Leu, L)
n = 615 (16.24%)
Isoleucine (Ile, I)
n = 310 (8.19%)
Methionine (Met, M)
n = 237 (6.26%)
Proline (Pro, P)
n = 213 (5.63%)
Phenylalanine (Phe, F)
n = 215 (5.68%)
Tyrosine (Tyr, Y)
n = 128 (3.38%)
Tryptophan (Trp, W)
n = 112 (2.96%)
Aspartic acid (Asp, D)
n = 61 (1.61%)
Glutamic acid (Glu, E)
n = 92 (2.43%)
Asparagine (Asn, N)
n = 149 (3.94%)
Glutamine (Gln, Q)
n = 102 (2.69%)
Histidine (His, H)
n = 99 (2.61%)
Lysine (Lys, K)
n = 90 (2.38%)
Arginine (Arg, R)
n = 70 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
131 179 215 59 70 319 7 150 101 1 35 16 82 13 82 133
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
22 12 14 50 103 84 4 31 62 105 20 26 39 145 3 53
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
153 166 3 26 74 133 1 12 36 51 77 6 10 42 107 33
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
66 88 4 25 36 89 1 9 8 53 0 0 2 4 0 106
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
758 939 1211 879
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
476 1063 725 1523
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
97 1173 1840 677

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.