Viewing data for Ursus maritimus


Scientific name Ursus maritimus
Common name Polar bear
Maximum lifespan 43.80 years (Ursus maritimus@AnAge)

Total mtDNA (size: 17017 bases) GC AT G C A T
Base content (bases) 7038 9979 4346 2692 4726 5253
Base content per 1 kb (bases) 414 586 255 158 278 309
Base content (%) 41.4% 58.6%
Total protein-coding genes (size: 11341 bases) GC AT G C A T
Base content (bases) 4678 6663 3060 1618 3261 3402
Base content per 1 kb (bases) 412 588 270 143 288 300
Base content (%) 41.2% 58.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1507 bases) GC AT G C A T
Base content (bases) 547 960 304 243 428 532
Base content per 1 kb (bases) 363 637 202 161 284 353
Base content (%) 36.3% 63.7%
Total rRNA-coding genes (size: 2542 bases) GC AT G C A T
Base content (bases) 1032 1510 558 474 604 906
Base content per 1 kb (bases) 406 594 220 186 238 356
Base content (%) 40.6% 59.4%
12S rRNA gene (size: 963 bases) GC AT G C A T
Base content (bases) 405 558 217 188 226 332
Base content per 1 kb (bases) 421 579 225 195 235 345
Base content (%) 42.1% 57.9%
16S rRNA gene (size: 1579 bases) GC AT G C A T
Base content (bases) 627 952 341 286 378 574
Base content per 1 kb (bases) 397 603 216 181 239 364
Base content (%) 39.7% 60.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 284 397 183 101 211 186
Base content per 1 kb (bases) 417 583 269 148 310 273
Base content (%) 41.7% 58.3%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 70 134 51 19 57 77
Base content per 1 kb (bases) 343 657 250 93 279 377
Base content (%) 34.3% 65.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 661 884 366 295 484 400
Base content per 1 kb (bases) 428 572 237 191 313 259
Base content (%) 42.8% 57.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 279 405 162 117 191 214
Base content per 1 kb (bases) 408 592 237 171 279 313
Base content (%) 40.8% 59.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 340 444 211 129 236 208
Base content per 1 kb (bases) 434 566 269 165 301 265
Base content (%) 43.4% 56.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 504 636 336 168 311 325
Base content per 1 kb (bases) 442 558 295 147 273 285
Base content (%) 44.2% 55.8%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 399 558 274 125 273 285
Base content per 1 kb (bases) 417 583 286 131 285 298
Base content (%) 41.7% 58.3%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 410 634 295 115 284 350
Base content per 1 kb (bases) 393 607 283 110 272 335
Base content (%) 39.3% 60.7%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 145 201 95 50 103 98
Base content per 1 kb (bases) 419 581 275 145 298 283
Base content (%) 41.9% 58.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 571 807 386 185 398 409
Base content per 1 kb (bases) 414 586 280 134 289 297
Base content (%) 41.4% 58.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 115 182 69 46 105 77
Base content per 1 kb (bases) 387 613 232 155 354 259
Base content (%) 38.7% 61.3%
ND5 (size: 1829 bases) GC AT G C A T
Base content (bases) 730 1099 506 224 518 581
Base content per 1 kb (bases) 399 601 277 122 283 318
Base content (%) 39.9% 60.1%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 194 334 143 51 115 219
Base content per 1 kb (bases) 367 633 271 97 218 415
Base content (%) 36.7% 63.3%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 17 (7.52%)
Threonine (Thr, T)
n = 26 (11.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.75%)
Leucine (Leu, L)
n = 40 (17.7%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 9 (3.98%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 14 (6.19%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 7 (3.1%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 8 5 2 4 17 5 8 5 3 2 2 6 3 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 6 5 4 0 2 2 5 2 8 2 1 3 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 1 3 2 5 0 2 5 0 3 2 4 4 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 2 0 2 2 0 1 3 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 62 78 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 65 35 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 56 73 67
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWSITILSMVLTLFIALQLKVSKYKYPEIPEPKSLSSSKKLVPWEEKWTKIYLPLLSPQR*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.49%)
Serine (Ser, S)
n = 9 (13.43%)
Threonine (Thr, T)
n = 5 (7.46%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (4.48%)
Leucine (Leu, L)
n = 11 (16.42%)
Isoleucine (Ile, I)
n = 5 (7.46%)
Methionine (Met, M)
n = 2 (2.99%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 1 (1.49%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 4 (5.97%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 8 (11.94%)
Arginine (Arg, R)
n = 1 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 1 3 1 4 0 3 3 0 1 1 1 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 3 2 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 1 2 1 6 0 0 0 1 2 0 0 0 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 2 1 0 7 1 0 0 1 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
9 19 20 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 22 20 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 10 37 15
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 42 (8.17%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 36 (7.0%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 35 (6.81%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 14 22 13 2 14 16 9 3 3 9 8 12 8 16 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 0 1 11 14 14 3 6 9 22 10 16 4 7 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 3 13 3 12 0 0 3 11 8 2 4 8 10 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 4 6 8 9 0 1 0 5 2 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 105 139 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
69 127 166 153
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 16 (7.05%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 10 10 2 5 13 4 5 5 2 1 3 5 4 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 3 1 5 0 1 3 2 2 2 4 6 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 7 2 1 6 7 1 3 1 9 1 0 4 4 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 12 4 6 4 3 1 1 0 2 3 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 57 66 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 50 87 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 23 (8.85%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 3 8 7 7 15 1 3 7 0 3 6 6 2 12 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 2 4 9 1 1 6 10 2 1 4 5 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 9 0 2 5 8 2 2 4 6 5 1 1 1 4 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 4 3 0 0 2 0 1 2 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 70 58 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 53 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 75 97 67
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 10 (2.64%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 21 5 5 9 36 4 5 5 1 3 5 8 1 14 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 3 5 9 10 2 0 7 17 2 3 10 9 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 2 2 9 9 2 0 2 6 8 2 1 4 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 4 8 7 2 0 0 6 2 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 104 104 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 97 75 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 135 146 71
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 29 (9.12%)
Serine (Ser, S)
n = 19 (5.97%)
Threonine (Thr, T)
n = 27 (8.49%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 18 (5.66%)
Leucine (Leu, L)
n = 55 (17.3%)
Isoleucine (Ile, I)
n = 23 (7.23%)
Methionine (Met, M)
n = 19 (5.97%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 20 (6.29%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 13 (4.09%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 8 16 4 12 23 7 8 5 1 1 7 8 2 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 14 10 0 2 3 7 0 7 9 6 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 14 1 4 1 11 1 0 2 4 8 1 1 4 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 1 2 7 0 1 2 5 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 86 91 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 95 57 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 93 137 69
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 25 (7.2%)
Serine (Ser, S)
n = 27 (7.78%)
Threonine (Thr, T)
n = 30 (8.65%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.75%)
Leucine (Leu, L)
n = 55 (15.85%)
Isoleucine (Ile, I)
n = 38 (10.95%)
Methionine (Met, M)
n = 34 (9.8%)
Proline (Pro, P)
n = 23 (6.63%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 25 24 5 9 31 3 4 8 0 4 3 6 0 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 0 6 8 11 0 0 9 5 2 7 7 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 19 0 3 9 11 2 0 2 3 6 0 3 8 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 1 1 14 0 0 1 2 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 88 133 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 103 60 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 104 157 64
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 25 (7.2%)
Serine (Ser, S)
n = 27 (7.78%)
Threonine (Thr, T)
n = 30 (8.65%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.75%)
Leucine (Leu, L)
n = 55 (15.85%)
Isoleucine (Ile, I)
n = 38 (10.95%)
Methionine (Met, M)
n = 34 (9.8%)
Proline (Pro, P)
n = 23 (6.63%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 25 24 5 9 31 3 4 8 0 4 3 6 0 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 0 6 8 11 0 0 9 5 2 7 7 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 19 0 3 9 11 2 0 2 3 6 0 3 8 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 1 1 14 0 0 1 2 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 88 133 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 103 60 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 104 157 64
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 20 (4.37%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 32 (6.99%)
Methionine (Met, M)
n = 32 (6.99%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 20 (4.37%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 20 (4.37%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 9 (1.97%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 20 21 14 14 42 14 12 10 1 3 5 12 0 11 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 2 2 8 8 10 5 2 7 8 1 8 8 6 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 17 2 6 12 6 1 7 7 7 9 2 2 10 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 2 1 2 8 5 0 1 9 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 136 151 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 118 80 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 132 178 103
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 13 (13.27%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 7 (7.14%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 4 1 3 8 6 4 2 0 4 1 7 1 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 3 2 2 0 1 0 3 0 2 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 0 2 5 0 0 0 0 3 1 0 0 4 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 2 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
27 25 23 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 21 19 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 23 35 30
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 43 (7.1%)
Serine (Ser, S)
n = 44 (7.26%)
Threonine (Thr, T)
n = 54 (8.91%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 25 (4.13%)
Leucine (Leu, L)
n = 88 (14.52%)
Isoleucine (Ile, I)
n = 60 (9.9%)
Methionine (Met, M)
n = 39 (6.44%)
Proline (Pro, P)
n = 24 (3.96%)
Phenylalanine (Phe, F)
n = 44 (7.26%)
Tyrosine (Tyr, Y)
n = 20 (3.3%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 30 (4.95%)
Glutamine (Gln, Q)
n = 21 (3.47%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 37 34 13 18 40 6 8 18 3 2 7 15 1 17 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 3 7 18 17 1 2 5 17 4 6 6 10 2 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 18 2 11 10 10 2 4 7 4 16 2 3 17 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 3 3 8 16 7 1 3 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
120 145 217 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 154 134 256
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 204 228 134
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.29%)
Alanine (Ala, A)
n = 8 (4.57%)
Serine (Ser, S)
n = 13 (7.43%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 20 (11.43%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 2 1 3 0 2 0 13 0 1 10 3 7 4 12 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 0 3 3 1 1 8 2 4 11 2 1 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 7 0 0 1 5 0 7 2 0 2 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 5 5 0 3 1 1 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 10 44 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 27 31 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 14 40 86
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 265 (6.97%)
Serine (Ser, S)
n = 279 (7.34%)
Threonine (Thr, T)
n = 303 (7.97%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 216 (5.68%)
Leucine (Leu, L)
n = 602 (15.84%)
Isoleucine (Ile, I)
n = 319 (8.39%)
Methionine (Met, M)
n = 228 (6.0%)
Proline (Pro, P)
n = 198 (5.21%)
Phenylalanine (Phe, F)
n = 238 (6.26%)
Tyrosine (Tyr, Y)
n = 133 (3.5%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 70 (1.84%)
Glutamic acid (Glu, E)
n = 101 (2.66%)
Asparagine (Asn, N)
n = 143 (3.76%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 98 (2.58%)
Lysine (Lys, K)
n = 100 (2.63%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
165 154 156 75 89 258 68 87 72 16 44 51 95 26 122 116
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
72 8 17 60 92 98 15 26 53 101 37 67 60 61 10 85
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
72 129 17 56 66 86 13 24 34 63 70 13 25 68 75 37
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
61 69 32 34 36 79 21 5 10 40 10 1 0 6 3 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
869 939 1152 842
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
470 987 742 1603
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
378 1056 1429 939

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.