Viewing data for Tylototriton verrucosus


Scientific name Tylototriton verrucosus
Common name Mandarin salamander
Maximum lifespan 11.00 years (Tylototriton verrucosus@AnAge)

Total mtDNA (size: 17100 bases) GC AT G C A T
Base content (bases) 6952 10148 4504 2448 4331 5817
Base content per 1 kb (bases) 407 593 263 143 253 340
Base content (%) 40.7% 59.3%
Total protein-coding genes (size: 11348 bases) GC AT G C A T
Base content (bases) 4690 6658 3163 1527 2921 3737
Base content per 1 kb (bases) 413 587 279 135 257 329
Base content (%) 41.3% 58.7%
D-loop (size: 737 bases) GC AT G C A T
Base content (bases) 273 464 158 115 256 208
Base content per 1 kb (bases) 370 630 214 156 347 282
Base content (%) 37.0% 63.0%
Total tRNA-coding genes (size: 1606 bases) GC AT G C A T
Base content (bases) 605 1001 356 249 437 564
Base content per 1 kb (bases) 377 623 222 155 272 351
Base content (%) 37.7% 62.3%
Total rRNA-coding genes (size: 2488 bases) GC AT G C A T
Base content (bases) 958 1530 535 423 542 988
Base content per 1 kb (bases) 385 615 215 170 218 397
Base content (%) 38.5% 61.5%
12S rRNA gene (size: 926 bases) GC AT G C A T
Base content (bases) 396 530 223 173 179 351
Base content per 1 kb (bases) 428 572 241 187 193 379
Base content (%) 42.8% 57.2%
16S rRNA gene (size: 1562 bases) GC AT G C A T
Base content (bases) 562 1000 312 250 363 637
Base content per 1 kb (bases) 360 640 200 160 232 408
Base content (%) 36.0% 64.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 284 400 199 85 182 218
Base content per 1 kb (bases) 415 585 291 124 266 319
Base content (%) 41.5% 58.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 53 115 42 11 42 73
Base content per 1 kb (bases) 315 685 250 65 250 435
Base content (%) 31.5% 68.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 696 855 418 278 442 413
Base content per 1 kb (bases) 449 551 270 179 285 266
Base content (%) 44.9% 55.1%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 288 400 182 106 173 227
Base content per 1 kb (bases) 419 581 265 154 251 330
Base content (%) 41.9% 58.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 366 418 235 131 196 222
Base content per 1 kb (bases) 467 533 300 167 250 283
Base content (%) 46.7% 53.3%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 489 652 326 163 302 350
Base content per 1 kb (bases) 429 571 286 143 265 307
Base content (%) 42.9% 57.1%
ND1 (size: 969 bases) GC AT G C A T
Base content (bases) 365 604 244 121 267 337
Base content per 1 kb (bases) 377 623 252 125 276 348
Base content (%) 37.7% 62.3%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 395 649 292 103 250 399
Base content per 1 kb (bases) 378 622 280 99 239 382
Base content (%) 37.8% 62.2%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 145 201 96 49 101 100
Base content per 1 kb (bases) 419 581 277 142 292 289
Base content (%) 41.9% 58.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 579 799 412 167 345 454
Base content per 1 kb (bases) 420 580 299 121 250 329
Base content (%) 42.0% 58.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 124 173 82 42 83 90
Base content per 1 kb (bases) 418 582 276 141 279 303
Base content (%) 41.8% 58.2%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 696 1116 477 219 487 629
Base content per 1 kb (bases) 384 616 263 121 269 347
Base content (%) 38.4% 61.6%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 222 297 166 56 59 238
Base content per 1 kb (bases) 428 572 320 108 114 459
Base content (%) 42.8% 57.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 56 (24.67%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 7 13 15 6 23 3 7 7 1 0 4 6 2 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 0 7 6 0 1 3 6 1 0 3 12 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 15 0 3 0 3 0 0 5 2 1 0 2 2 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 1 0 2 1 0 1 3 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 80 73 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 59 33 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 60 112 38
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPHPWFAILLSSWVIYLTILTPKVNNFKYQNNPNLQNTQKEKMQPWNWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 8 (14.55%)
Glutamine (Gln, Q)
n = 5 (9.09%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 0 0 1 1 0 4 5 0 2 0 0 0 2 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 0 0 0 0 0 0 1 2 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 0 0 2 0 0 0 0 2 0 0 3 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 15 21 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 14 22 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 13 30 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 40 (7.75%)
Serine (Ser, S)
n = 34 (6.59%)
Threonine (Thr, T)
n = 38 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (6.98%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 30 (5.81%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 19 20 11 16 20 4 7 6 1 9 7 17 3 19 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 10 17 10 3 7 15 18 6 3 5 15 7 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 16 7 5 4 18 3 0 4 6 11 3 3 7 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 2 3 12 7 1 1 0 7 1 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 117 136 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 138 93 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 163 184 116
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 19 (8.33%)
Serine (Ser, S)
n = 17 (7.46%)
Threonine (Thr, T)
n = 14 (6.14%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 15 (6.58%)
Leucine (Leu, L)
n = 24 (10.53%)
Isoleucine (Ile, I)
n = 19 (8.33%)
Methionine (Met, M)
n = 16 (7.02%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 7 (3.07%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 11 (4.82%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 7 (3.07%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 9 (3.95%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 11 4 2 10 1 7 9 0 3 4 6 2 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 2 9 7 1 1 5 1 1 4 2 6 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 12 0 2 1 10 0 0 4 5 2 1 0 3 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 1 2 9 3 1 0 1 5 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 55 64 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 60 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 67 103 44
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 11 8 2 8 14 4 6 8 0 4 2 8 1 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 1 9 12 0 2 8 7 4 1 3 8 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 1 5 5 1 0 3 3 7 0 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 2 0 5 2 1 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 68 55 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 54 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 101 113 32
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 54 (14.25%)
Isoleucine (Ile, I)
n = 38 (10.03%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 24 13 8 7 25 7 7 5 2 2 6 10 0 10 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 1 10 10 0 0 6 12 9 2 2 17 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 14 0 4 4 15 1 0 2 2 13 0 0 4 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 1 0 9 9 2 0 1 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 97 110 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 92 78 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 137 162 52
ND1 (size: 969 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.59%)
Alanine (Ala, A)
n = 24 (7.45%)
Serine (Ser, S)
n = 26 (8.07%)
Threonine (Thr, T)
n = 22 (6.83%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.73%)
Leucine (Leu, L)
n = 59 (18.32%)
Isoleucine (Ile, I)
n = 30 (9.32%)
Methionine (Met, M)
n = 23 (7.14%)
Proline (Pro, P)
n = 21 (6.52%)
Phenylalanine (Phe, F)
n = 17 (5.28%)
Tyrosine (Tyr, Y)
n = 9 (2.8%)
Tryptophan (Trp, W)
n = 7 (2.17%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 12 (3.73%)
Glutamine (Gln, Q)
n = 8 (2.48%)
Histidine (His, H)
n = 4 (1.24%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 17 18 8 7 26 1 17 5 3 0 1 10 1 11 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 2 6 15 1 0 3 14 1 1 3 17 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 17 1 1 5 16 0 0 4 6 3 0 0 5 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 1 2 6 1 0 3 5 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 83 98 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 89 55 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 72 184 52
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 25 (7.2%)
Serine (Ser, S)
n = 33 (9.51%)
Threonine (Thr, T)
n = 49 (14.12%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 61 (17.58%)
Isoleucine (Ile, I)
n = 23 (6.63%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 15 (4.32%)
Phenylalanine (Phe, F)
n = 10 (2.88%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 19 (5.48%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 12 32 6 5 35 3 10 10 0 1 1 4 1 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 2 11 11 1 1 3 8 2 1 2 10 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 32 1 5 5 18 1 1 3 2 4 1 2 5 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 0 2 10 0 0 0 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 86 140 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 118 60 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 88 199 44
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 25 (7.2%)
Serine (Ser, S)
n = 33 (9.51%)
Threonine (Thr, T)
n = 49 (14.12%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 61 (17.58%)
Isoleucine (Ile, I)
n = 23 (6.63%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 15 (4.32%)
Phenylalanine (Phe, F)
n = 10 (2.88%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 19 (5.48%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 12 32 6 5 35 3 10 10 0 1 1 4 1 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 2 11 11 1 1 3 8 2 1 2 10 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 32 1 5 5 18 1 1 3 2 4 1 2 5 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 0 2 10 0 0 0 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 86 140 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 118 60 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 88 199 44
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.37%)
Alanine (Ala, A)
n = 34 (7.42%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 51 (11.14%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 88 (19.21%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 14 (3.06%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 15 (3.28%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 20 32 11 21 34 7 13 9 1 4 2 5 1 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 4 14 13 3 0 5 12 3 1 3 21 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 23 2 3 2 22 2 2 4 6 7 2 2 2 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 2 0 2 10 0 0 2 7 2 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 132 159 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 141 73 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 139 222 65
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 13 (13.27%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 2 (2.04%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 5 4 4 7 3 3 1 0 0 0 2 0 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 3 4 0 0 1 3 1 0 0 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 7 1 2 2 5 1 0 3 0 0 0 0 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 0 2 0 1 2 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 26 33 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 32 14 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 24 43 21
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.64%)
Alanine (Ala, A)
n = 40 (6.63%)
Serine (Ser, S)
n = 57 (9.45%)
Threonine (Thr, T)
n = 57 (9.45%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 18 (2.99%)
Leucine (Leu, L)
n = 78 (12.94%)
Isoleucine (Ile, I)
n = 57 (9.45%)
Methionine (Met, M)
n = 49 (8.13%)
Proline (Pro, P)
n = 27 (4.48%)
Phenylalanine (Phe, F)
n = 41 (6.8%)
Tyrosine (Tyr, Y)
n = 13 (2.16%)
Tryptophan (Trp, W)
n = 13 (2.16%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 12 (1.99%)
Asparagine (Asn, N)
n = 32 (5.31%)
Glutamine (Gln, Q)
n = 20 (3.32%)
Histidine (His, H)
n = 9 (1.49%)
Lysine (Lys, K)
n = 25 (4.15%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 31 41 8 14 30 9 15 16 4 4 5 8 1 22 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 5 3 15 22 0 1 13 11 3 2 2 20 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 34 1 9 8 27 0 2 11 5 8 2 2 11 21 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 2 5 6 20 5 0 2 7 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 126 233 136
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 168 123 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 183 273 108
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (11.63%)
Alanine (Ala, A)
n = 16 (9.3%)
Serine (Ser, S)
n = 15 (8.72%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 6 (3.49%)
Valine (Val, V)
n = 32 (18.6%)
Leucine (Leu, L)
n = 28 (16.28%)
Isoleucine (Ile, I)
n = 5 (2.91%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 12 (6.98%)
Tyrosine (Tyr, Y)
n = 9 (5.23%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 2 5 0 0 3 11 0 0 18 1 3 10 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 5 1 9 0 2 5 7 1 1 11 3 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 10 0 0 1 3 1 9 0 4 9 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 3 4 0 0 1 2 0 0 2 1 0 0 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 17 19 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 33 19 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 6 21 94
Total protein-coding genes (size: 11381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 224 (5.91%)
Alanine (Ala, A)
n = 270 (7.12%)
Serine (Ser, S)
n = 290 (7.65%)
Threonine (Thr, T)
n = 327 (8.63%)
Cysteine (Cys, C)
n = 31 (0.82%)
Valine (Val, V)
n = 184 (4.85%)
Leucine (Leu, L)
n = 599 (15.8%)
Isoleucine (Ile, I)
n = 299 (7.89%)
Methionine (Met, M)
n = 252 (6.65%)
Proline (Pro, P)
n = 207 (5.46%)
Phenylalanine (Phe, F)
n = 222 (5.86%)
Tyrosine (Tyr, Y)
n = 106 (2.8%)
Tryptophan (Trp, W)
n = 111 (2.93%)
Aspartic acid (Asp, D)
n = 67 (1.77%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 149 (3.93%)
Glutamine (Gln, Q)
n = 95 (2.51%)
Histidine (His, H)
n = 96 (2.53%)
Lysine (Lys, K)
n = 89 (2.35%)
Arginine (Arg, R)
n = 73 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
146 153 198 87 95 235 46 112 83 12 48 33 81 22 111 111
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
54 12 19 37 107 112 14 20 66 95 43 19 27 140 21 35
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
90 189 13 45 37 146 10 8 44 46 60 14 24 43 106 20
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 76 17 16 51 76 13 3 10 53 7 1 0 6 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
838 934 1169 851
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
492 1042 702 1556
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
311 1085 1700 696

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.