Viewing data for Cecropis daurica


Scientific name Cecropis daurica
Common name Red-rumped swallow
Maximum lifespan 9.00 years (Cecropis daurica@AnAge)

Total mtDNA (size: 17949 bases) GC AT G C A T
Base content (bases) 8338 9611 5768 2570 4135 5476
Base content per 1 kb (bases) 465 535 321 143 230 305
Base content (%) 46.5% 53.5%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5391 5987 3919 1472 2588 3399
Base content per 1 kb (bases) 474 526 344 129 227 299
Base content (%) 47.4% 52.6%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1543 bases) GC AT G C A T
Base content (bases) 659 884 394 265 370 514
Base content per 1 kb (bases) 427 573 255 172 240 333
Base content (%) 42.7% 57.3%
Total rRNA-coding genes (size: 2574 bases) GC AT G C A T
Base content (bases) 1192 1382 666 526 523 859
Base content per 1 kb (bases) 463 537 259 204 203 334
Base content (%) 46.3% 53.7%
12S rRNA gene (size: 973 bases) GC AT G C A T
Base content (bases) 471 502 263 208 195 307
Base content per 1 kb (bases) 484 516 270 214 200 316
Base content (%) 48.4% 51.6%
16S rRNA gene (size: 1601 bases) GC AT G C A T
Base content (bases) 721 880 403 318 328 552
Base content per 1 kb (bases) 450 550 252 199 205 345
Base content (%) 45.0% 55.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 313 371 245 68 160 211
Base content per 1 kb (bases) 458 542 358 99 234 308
Base content (%) 45.8% 54.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 58 11 44 55
Base content per 1 kb (bases) 411 589 345 65 262 327
Base content (%) 41.1% 58.9%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 747 804 488 259 372 432
Base content per 1 kb (bases) 482 518 315 167 240 279
Base content (%) 48.2% 51.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 316 368 212 104 159 209
Base content per 1 kb (bases) 462 538 310 152 232 306
Base content (%) 46.2% 53.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 375 409 251 124 201 208
Base content per 1 kb (bases) 478 522 320 158 256 265
Base content (%) 47.8% 52.2%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 545 598 398 147 277 321
Base content per 1 kb (bases) 477 523 348 129 242 281
Base content (%) 47.7% 52.3%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 472 506 331 141 230 276
Base content per 1 kb (bases) 483 517 338 144 235 282
Base content (%) 48.3% 51.7%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 490 550 377 113 227 323
Base content per 1 kb (bases) 471 529 363 109 218 311
Base content (%) 47.1% 52.9%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 166 185 123 43 87 98
Base content per 1 kb (bases) 473 527 350 123 248 279
Base content (%) 47.3% 52.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 657 721 495 162 302 419
Base content per 1 kb (bases) 477 523 359 118 219 304
Base content (%) 47.7% 52.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 143 154 102 41 76 78
Base content per 1 kb (bases) 481 519 343 138 256 263
Base content (%) 48.1% 51.9%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 855 963 645 210 401 562
Base content per 1 kb (bases) 470 530 355 116 221 309
Base content (%) 47.0% 53.0%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 248 271 197 51 56 215
Base content per 1 kb (bases) 478 522 380 98 108 414
Base content (%) 47.8% 52.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 64 (28.19%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 7 (3.08%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 16 4 4 13 39 4 4 8 0 1 2 5 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 0 10 5 0 2 1 2 3 0 6 8 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 0 6 7 0 1 3 0 3 0 0 2 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 0 1 4 0 1 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 91 68 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 66 35 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 88 108 21
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPTPWFFIMLISWSTFSLLIQPKILTFLTTNPPSNKAVTTPTTSPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 11 (20.0%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 0 0 2 2 1 1 1 1 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 0 0 0 0 0 0 3 1 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 0 0 3 2 0 0 0 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 16 22 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 26 8 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 16 25 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 38 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.17%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 43 (8.33%)
Methionine (Met, M)
n = 23 (4.46%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 44 (8.53%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 31 18 6 12 35 5 3 7 2 2 8 25 2 5 39
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 4 22 19 0 4 14 21 8 7 7 15 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 12 1 2 10 12 0 0 4 5 12 1 0 2 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
19 9 1 1 14 9 0 1 2 5 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 125 132 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 226 206 58
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 13 (5.73%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 9 7 3 5 16 2 5 5 2 3 7 7 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 5 9 4 1 3 1 4 0 3 4 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 0 1 6 6 0 0 4 3 5 1 0 0 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 2 3 8 5 0 0 2 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 59 58 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 62 60 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 91 91 35
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 11 5 3 5 16 4 4 7 0 4 5 7 0 4 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 13 9 0 3 6 7 3 1 5 6 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 0 4 4 5 0 0 4 1 10 0 0 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 0 2 4 4 0 2 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 70 54 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 111 100 40
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 27 (7.11%)
Serine (Ser, S)
n = 26 (6.84%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 21 (5.53%)
Leucine (Leu, L)
n = 69 (18.16%)
Isoleucine (Ile, I)
n = 32 (8.42%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 26 (6.84%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 19 (5.0%)
Glutamine (Gln, Q)
n = 7 (1.84%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 29 6 11 24 28 2 4 7 0 0 10 9 2 5 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 6 13 8 0 3 4 15 2 1 8 14 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 1 0 13 11 0 0 2 1 11 0 0 3 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 1 2 7 10 0 1 1 6 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 116 95 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 100 77 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 182 149 40
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 32 (9.85%)
Serine (Ser, S)
n = 25 (7.69%)
Threonine (Thr, T)
n = 20 (6.15%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 14 (4.31%)
Leucine (Leu, L)
n = 65 (20.0%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 12 (3.69%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 13 (4.0%)
Glutamine (Gln, Q)
n = 7 (2.15%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 20 9 6 12 34 3 9 6 1 0 6 4 4 3 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 4 15 12 1 2 6 3 3 1 8 12 3 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 7 2 1 10 8 0 0 6 1 14 0 1 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 0 4 5 2 0 0 8 0 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 96 83 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 95 59 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 140 134 26
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.06%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 28 (8.12%)
Threonine (Thr, T)
n = 48 (13.91%)
Cysteine (Cys, C)
n = 3 (0.87%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 29 (8.41%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 22 15 7 14 29 8 4 9 1 2 1 4 0 0 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 3 12 11 1 0 4 8 2 2 11 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 15 2 1 13 9 1 0 4 2 5 1 1 1 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 3 1 0 1 10 4 1 0 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 102 127 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 120 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 155 136 29
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.06%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 28 (8.12%)
Threonine (Thr, T)
n = 48 (13.91%)
Cysteine (Cys, C)
n = 3 (0.87%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 29 (8.41%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 22 15 7 14 29 8 4 9 1 2 1 4 0 0 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 3 12 11 1 0 4 8 2 2 11 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 15 2 1 13 9 1 0 4 2 5 1 1 1 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 3 1 0 1 10 4 1 0 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 102 127 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 120 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 155 136 29
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 42 (9.17%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 38 (8.3%)
Methionine (Met, M)
n = 28 (6.11%)
Proline (Pro, P)
n = 29 (6.33%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 15 (3.28%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 15 (3.28%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 31 22 6 23 51 5 7 13 0 3 5 4 0 1 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 2 21 17 2 3 8 5 2 2 20 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 20 0 1 13 13 2 0 10 1 14 3 0 2 13 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 4 0 2 11 0 0 1 10 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 153 143 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 141 81 183
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 201 195 39
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 6 2 1 11 3 2 3 0 0 3 0 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 0 7 3 0 1 2 1 0 2 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 2 4 3 0 0 4 0 2 0 1 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 1 1 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 29 26 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 17 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 44 35 13
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.29%)
Alanine (Ala, A)
n = 51 (8.43%)
Serine (Ser, S)
n = 49 (8.1%)
Threonine (Thr, T)
n = 64 (10.58%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 16 (2.64%)
Leucine (Leu, L)
n = 103 (17.02%)
Isoleucine (Ile, I)
n = 58 (9.59%)
Methionine (Met, M)
n = 28 (4.63%)
Proline (Pro, P)
n = 32 (5.29%)
Phenylalanine (Phe, F)
n = 32 (5.29%)
Tyrosine (Tyr, Y)
n = 14 (2.31%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 28 (4.63%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 44 24 9 23 65 4 2 18 1 1 5 7 3 7 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 6 5 32 13 1 0 13 18 1 4 12 13 3 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
30 24 1 2 25 12 1 0 9 2 12 3 0 2 26 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 1 1 7 20 0 0 4 5 0 1 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
118 174 208 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 187 113 237
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 284 241 58
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.86%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 12 (6.98%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 34 (19.77%)
Leucine (Leu, L)
n = 30 (17.44%)
Isoleucine (Ile, I)
n = 4 (2.33%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 10 (5.81%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 5 (2.91%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 3 0 2 5 5 0 0 21 0 3 10 10 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 5 0 2 5 7 3 0 19 3 0 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 4 0 1 5 2 0 7 0 2 15 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 1 5 0 1 0 1 0 0 3 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 18 18 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 28 18 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
73 5 20 75
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 222 (5.85%)
Alanine (Ala, A)
n = 313 (8.25%)
Serine (Ser, S)
n = 283 (7.46%)
Threonine (Thr, T)
n = 330 (8.69%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 189 (4.98%)
Leucine (Leu, L)
n = 662 (17.44%)
Isoleucine (Ile, I)
n = 293 (7.72%)
Methionine (Met, M)
n = 161 (4.24%)
Proline (Pro, P)
n = 222 (5.85%)
Phenylalanine (Phe, F)
n = 215 (5.66%)
Tyrosine (Tyr, Y)
n = 113 (2.98%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 85 (2.24%)
Asparagine (Asn, N)
n = 136 (3.58%)
Glutamine (Gln, Q)
n = 96 (2.53%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 88 (2.32%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
70 223 121 66 140 339 49 50 88 8 37 52 78 22 45 170
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 4 26 37 159 106 11 28 64 86 44 30 86 95 11 39
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
155 129 7 19 111 90 9 3 51 24 89 11 18 17 119 19
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
85 71 14 14 52 82 6 7 12 50 3 1 2 5 2 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
875 1088 1065 769
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
488 1094 695 1520
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
257 1594 1487 459

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.