Viewing data for Daboia russellii


Scientific name Daboia russellii
Common name Russell's viper
Maximum lifespan 15.00 years (Daboia russellii@AnAge)

Total mtDNA (size: 17246 bases) GC AT G C A T
Base content (bases) 6762 10484 4687 2075 4858 5626
Base content per 1 kb (bases) 392 608 272 120 282 326
Base content (%) 39.2% 60.8%
Total protein-coding genes (size: 11274 bases) GC AT G C A T
Base content (bases) 4410 6864 3202 1208 3200 3664
Base content per 1 kb (bases) 391 609 284 107 284 325
Base content (%) 39.1% 60.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1406 bases) GC AT G C A T
Base content (bases) 555 851 325 230 381 470
Base content per 1 kb (bases) 395 605 231 164 271 334
Base content (%) 39.5% 60.5%
Total rRNA-coding genes (size: 2391 bases) GC AT G C A T
Base content (bases) 949 1442 569 380 555 887
Base content per 1 kb (bases) 397 603 238 159 232 371
Base content (%) 39.7% 60.3%
12S rRNA gene (size: 908 bases) GC AT G C A T
Base content (bases) 372 536 219 153 203 333
Base content per 1 kb (bases) 410 590 241 169 224 367
Base content (%) 41.0% 59.0%
16S rRNA gene (size: 1483 bases) GC AT G C A T
Base content (bases) 577 906 350 227 352 554
Base content per 1 kb (bases) 389 611 236 153 237 374
Base content (%) 38.9% 61.1%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 254 427 190 64 207 220
Base content per 1 kb (bases) 373 627 279 94 304 323
Base content (%) 37.3% 62.7%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 51 114 41 10 51 63
Base content per 1 kb (bases) 309 691 248 61 309 382
Base content (%) 30.9% 69.1%
COX1 (size: 1602 bases) GC AT G C A T
Base content (bases) 662 940 417 245 489 451
Base content per 1 kb (bases) 413 587 260 153 305 282
Base content (%) 41.3% 58.7%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 281 404 180 101 183 221
Base content per 1 kb (bases) 410 590 263 147 267 323
Base content (%) 41.0% 59.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 314 470 201 113 232 238
Base content per 1 kb (bases) 401 599 256 144 296 304
Base content (%) 40.1% 59.9%
CYTB (size: 1114 bases) GC AT G C A T
Base content (bases) 441 673 327 114 334 339
Base content per 1 kb (bases) 396 604 294 102 300 304
Base content (%) 39.6% 60.4%
ND1 (size: 961 bases) GC AT G C A T
Base content (bases) 393 568 291 102 268 300
Base content per 1 kb (bases) 409 591 303 106 279 312
Base content (%) 40.9% 59.1%
ND2 (size: 1030 bases) GC AT G C A T
Base content (bases) 400 630 325 75 260 370
Base content per 1 kb (bases) 388 612 316 73 252 359
Base content (%) 38.8% 61.2%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 133 210 96 37 103 107
Base content per 1 kb (bases) 388 612 280 108 300 312
Base content (%) 38.8% 61.2%
ND4 (size: 1338 bases) GC AT G C A T
Base content (bases) 522 816 391 131 387 429
Base content per 1 kb (bases) 390 610 292 98 289 321
Base content (%) 39.0% 61.0%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 102 189 74 28 91 98
Base content per 1 kb (bases) 351 649 254 96 313 337
Base content (%) 35.1% 64.9%
ND5 (size: 1773 bases) GC AT G C A T
Base content (bases) 663 1110 501 162 504 606
Base content per 1 kb (bases) 374 626 283 91 284 342
Base content (%) 37.4% 62.6%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 196 323 169 27 93 230
Base content per 1 kb (bases) 378 622 326 52 179 443
Base content (%) 37.8% 62.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (2.21%)
Alanine (Ala, A)
n = 14 (6.19%)
Serine (Ser, S)
n = 20 (8.85%)
Threonine (Thr, T)
n = 19 (8.41%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 47 (20.8%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 20 (8.85%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 6 (2.65%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 6 (2.65%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 7 (3.1%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 12 18 12 10 15 1 8 6 0 2 4 4 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 6 4 4 0 1 2 2 0 5 2 6 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 9 2 3 3 7 0 2 5 3 1 0 1 3 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 1 0 1 6 1 0 2 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 64 86 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 60 39 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 66 95 57
ATP8 (size: 165 bases)
Amino acid sequence: MPQLDIVYICYTYLWTWFIITLMSQKMDLFKLTIKPKYPFLMKHQLSTSTLPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.56%)
Threonine (Thr, T)
n = 7 (12.96%)
Cysteine (Cys, C)
n = 1 (1.85%)
Valine (Val, V)
n = 1 (1.85%)
Leucine (Leu, L)
n = 8 (14.81%)
Isoleucine (Ile, I)
n = 5 (9.26%)
Methionine (Met, M)
n = 4 (7.41%)
Proline (Pro, P)
n = 4 (7.41%)
Phenylalanine (Phe, F)
n = 3 (5.56%)
Tyrosine (Tyr, Y)
n = 4 (7.41%)
Tryptophan (Trp, W)
n = 3 (5.56%)
Aspartic acid (Asp, D)
n = 2 (3.7%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 3 (5.56%)
Histidine (His, H)
n = 1 (1.85%)
Lysine (Lys, K)
n = 5 (9.26%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 3 2 1 3 1 1 3 0 1 0 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 0 0 0 0 0 0 0 0 1 1 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 0 0 2 0 0 1 4 0 0 0 0 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 1 1 5 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 15 22 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 13 16 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 13 25 15
COX1 (size: 1602 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.44%)
Alanine (Ala, A)
n = 34 (6.38%)
Serine (Ser, S)
n = 37 (6.94%)
Threonine (Thr, T)
n = 43 (8.07%)
Cysteine (Cys, C)
n = 5 (0.94%)
Valine (Val, V)
n = 30 (5.63%)
Leucine (Leu, L)
n = 61 (11.44%)
Isoleucine (Ile, I)
n = 45 (8.44%)
Methionine (Met, M)
n = 34 (6.38%)
Proline (Pro, P)
n = 33 (6.19%)
Phenylalanine (Phe, F)
n = 42 (7.88%)
Tyrosine (Tyr, Y)
n = 16 (3.0%)
Tryptophan (Trp, W)
n = 19 (3.56%)
Aspartic acid (Asp, D)
n = 13 (2.44%)
Glutamic acid (Glu, E)
n = 8 (1.5%)
Asparagine (Asn, N)
n = 19 (3.56%)
Glutamine (Gln, Q)
n = 9 (1.69%)
Histidine (His, H)
n = 18 (3.38%)
Lysine (Lys, K)
n = 13 (2.44%)
Arginine (Arg, R)
n = 9 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 23 30 12 7 19 3 20 8 1 8 9 11 2 16 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 3 4 16 12 2 10 8 18 9 11 6 16 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 11 2 9 10 12 0 3 3 8 8 2 0 9 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 5 3 8 5 11 2 5 1 3 0 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
130 110 161 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
85 141 96 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 166 194 144
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 27 (11.89%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 9 (3.96%)
Glutamic acid (Glu, E)
n = 17 (7.49%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 11 (4.85%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 7 12 5 3 11 0 7 9 2 6 2 7 0 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 3 5 8 2 1 3 4 1 3 5 4 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 6 0 1 6 7 0 0 1 4 4 1 1 1 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 17 0 6 3 3 0 0 1 5 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 57 56 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 63 61 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 60 104 55
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 12 (4.62%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 27 (10.38%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 19 (7.31%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 18 (6.92%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 6 (2.31%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 9 11 8 3 15 1 7 6 0 5 3 10 1 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 3 7 0 2 7 6 4 2 3 4 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 0 1 2 11 0 1 3 6 7 0 0 2 2 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 1 4 2 6 0 0 2 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 63 70 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 64 57 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 74 111 66
CYTB (size: 1114 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.14%)
Alanine (Ala, A)
n = 19 (5.14%)
Serine (Ser, S)
n = 32 (8.65%)
Threonine (Thr, T)
n = 36 (9.73%)
Cysteine (Cys, C)
n = 2 (0.54%)
Valine (Val, V)
n = 11 (2.97%)
Leucine (Leu, L)
n = 51 (13.78%)
Isoleucine (Ile, I)
n = 41 (11.08%)
Methionine (Met, M)
n = 17 (4.59%)
Proline (Pro, P)
n = 21 (5.68%)
Phenylalanine (Phe, F)
n = 27 (7.3%)
Tyrosine (Tyr, Y)
n = 14 (3.78%)
Tryptophan (Trp, W)
n = 11 (2.97%)
Aspartic acid (Asp, D)
n = 7 (1.89%)
Glutamic acid (Glu, E)
n = 7 (1.89%)
Asparagine (Asn, N)
n = 20 (5.41%)
Glutamine (Gln, Q)
n = 6 (1.62%)
Histidine (His, H)
n = 15 (4.05%)
Lysine (Lys, K)
n = 9 (2.43%)
Arginine (Arg, R)
n = 6 (1.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 23 14 11 8 23 1 8 6 0 4 3 2 2 9 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 2 10 7 0 3 7 8 1 4 2 14 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 11 0 8 7 16 0 0 1 9 5 1 0 8 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 1 3 4 8 1 0 1 4 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 91 124 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 107 78 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 129 137 93
ND1 (size: 961 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.02%)
Alanine (Ala, A)
n = 20 (6.27%)
Serine (Ser, S)
n = 30 (9.4%)
Threonine (Thr, T)
n = 27 (8.46%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 6 (1.88%)
Leucine (Leu, L)
n = 56 (17.55%)
Isoleucine (Ile, I)
n = 29 (9.09%)
Methionine (Met, M)
n = 22 (6.9%)
Proline (Pro, P)
n = 20 (6.27%)
Phenylalanine (Phe, F)
n = 19 (5.96%)
Tyrosine (Tyr, Y)
n = 11 (3.45%)
Tryptophan (Trp, W)
n = 8 (2.51%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 12 (3.76%)
Asparagine (Asn, N)
n = 15 (4.7%)
Glutamine (Gln, Q)
n = 8 (2.51%)
Histidine (His, H)
n = 2 (0.63%)
Lysine (Lys, K)
n = 8 (2.51%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 17 21 11 10 27 0 8 7 1 0 2 3 1 8 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 7 9 0 4 3 6 3 4 11 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 0 5 10 15 0 0 0 3 8 0 0 2 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 4 0 3 6 2 2 2 2 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 85 101 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 97 59 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 109 140 58
ND2 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.63%)
Alanine (Ala, A)
n = 22 (6.43%)
Serine (Ser, S)
n = 24 (7.02%)
Threonine (Thr, T)
n = 62 (18.13%)
Cysteine (Cys, C)
n = 3 (0.88%)
Valine (Val, V)
n = 2 (0.58%)
Leucine (Leu, L)
n = 58 (16.96%)
Isoleucine (Ile, I)
n = 32 (9.36%)
Methionine (Met, M)
n = 35 (10.23%)
Proline (Pro, P)
n = 21 (6.14%)
Phenylalanine (Phe, F)
n = 10 (2.92%)
Tyrosine (Tyr, Y)
n = 7 (2.05%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.75%)
Asparagine (Asn, N)
n = 15 (4.39%)
Glutamine (Gln, Q)
n = 5 (1.46%)
Histidine (His, H)
n = 6 (1.75%)
Lysine (Lys, K)
n = 10 (2.92%)
Arginine (Arg, R)
n = 5 (1.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 18 35 12 12 26 0 8 4 1 1 0 1 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 2 4 11 7 0 2 2 5 0 6 6 9 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 29 0 3 7 9 0 0 5 1 6 0 0 3 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 0 1 0 9 1 1 0 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 87 159 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 124 50 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 114 161 65
ND3 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.63%)
Alanine (Ala, A)
n = 22 (6.43%)
Serine (Ser, S)
n = 24 (7.02%)
Threonine (Thr, T)
n = 62 (18.13%)
Cysteine (Cys, C)
n = 3 (0.88%)
Valine (Val, V)
n = 2 (0.58%)
Leucine (Leu, L)
n = 58 (16.96%)
Isoleucine (Ile, I)
n = 32 (9.36%)
Methionine (Met, M)
n = 35 (10.23%)
Proline (Pro, P)
n = 21 (6.14%)
Phenylalanine (Phe, F)
n = 10 (2.92%)
Tyrosine (Tyr, Y)
n = 7 (2.05%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.75%)
Asparagine (Asn, N)
n = 15 (4.39%)
Glutamine (Gln, Q)
n = 5 (1.46%)
Histidine (His, H)
n = 6 (1.75%)
Lysine (Lys, K)
n = 10 (2.92%)
Arginine (Arg, R)
n = 5 (1.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 18 35 12 12 26 0 8 4 1 1 0 1 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 2 4 11 7 0 2 2 5 0 6 6 9 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 29 0 3 7 9 0 0 5 1 6 0 0 3 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 0 1 0 9 1 1 0 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 87 159 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 124 50 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 114 161 65
ND4 (size: 1338 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.37%)
Alanine (Ala, A)
n = 33 (7.42%)
Serine (Ser, S)
n = 38 (8.54%)
Threonine (Thr, T)
n = 45 (10.11%)
Cysteine (Cys, C)
n = 3 (0.67%)
Valine (Val, V)
n = 8 (1.8%)
Leucine (Leu, L)
n = 90 (20.22%)
Isoleucine (Ile, I)
n = 41 (9.21%)
Methionine (Met, M)
n = 34 (7.64%)
Proline (Pro, P)
n = 24 (5.39%)
Phenylalanine (Phe, F)
n = 20 (4.49%)
Tyrosine (Tyr, Y)
n = 10 (2.25%)
Tryptophan (Trp, W)
n = 10 (2.25%)
Aspartic acid (Asp, D)
n = 4 (0.9%)
Glutamic acid (Glu, E)
n = 10 (2.25%)
Asparagine (Asn, N)
n = 15 (3.37%)
Glutamine (Gln, Q)
n = 14 (3.15%)
Histidine (His, H)
n = 11 (2.47%)
Lysine (Lys, K)
n = 11 (2.47%)
Arginine (Arg, R)
n = 9 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 24 32 16 14 35 5 20 13 1 2 2 4 0 12 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 11 9 11 2 1 5 6 3 8 1 14 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 17 0 7 12 12 1 0 6 2 8 0 0 4 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 1 1 3 11 0 2 0 7 0 0 1 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 128 153 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 134 75 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 129 201 99
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 5 (5.21%)
Serine (Ser, S)
n = 11 (11.46%)
Threonine (Thr, T)
n = 11 (11.46%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 6 (6.25%)
Leucine (Leu, L)
n = 21 (21.88%)
Isoleucine (Ile, I)
n = 9 (9.38%)
Methionine (Met, M)
n = 9 (9.38%)
Proline (Pro, P)
n = 1 (1.04%)
Phenylalanine (Phe, F)
n = 1 (1.04%)
Tyrosine (Tyr, Y)
n = 2 (2.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 4 (4.17%)
Glutamine (Gln, Q)
n = 3 (3.13%)
Histidine (His, H)
n = 2 (2.08%)
Lysine (Lys, K)
n = 2 (2.08%)
Arginine (Arg, R)
n = 1 (1.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 4 8 3 3 9 1 5 3 0 0 1 5 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 1 2 2 0 0 1 1 1 1 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 0 2 3 4 0 1 1 0 2 0 0 3 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 1 0 2 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 23 37 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 26 17 46
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 25 44 25
ND5 (size: 1773 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.24%)
Alanine (Ala, A)
n = 33 (5.59%)
Serine (Ser, S)
n = 53 (8.98%)
Threonine (Thr, T)
n = 60 (10.17%)
Cysteine (Cys, C)
n = 2 (0.34%)
Valine (Val, V)
n = 8 (1.36%)
Leucine (Leu, L)
n = 93 (15.76%)
Isoleucine (Ile, I)
n = 70 (11.86%)
Methionine (Met, M)
n = 46 (7.8%)
Proline (Pro, P)
n = 30 (5.08%)
Phenylalanine (Phe, F)
n = 30 (5.08%)
Tyrosine (Tyr, Y)
n = 14 (2.37%)
Tryptophan (Trp, W)
n = 10 (1.69%)
Aspartic acid (Asp, D)
n = 12 (2.03%)
Glutamic acid (Glu, E)
n = 12 (2.03%)
Asparagine (Asn, N)
n = 30 (5.08%)
Glutamine (Gln, Q)
n = 20 (3.39%)
Histidine (His, H)
n = 11 (1.86%)
Lysine (Lys, K)
n = 23 (3.9%)
Arginine (Arg, R)
n = 8 (1.36%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 38 41 20 13 41 3 14 20 0 0 3 4 1 17 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 9 9 15 0 8 8 6 3 5 11 14 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 20 1 9 11 24 1 1 7 4 10 0 2 9 21 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 11 1 5 7 21 2 0 4 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 146 237 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 168 123 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 187 246 139
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.21%)
Alanine (Ala, A)
n = 3 (1.74%)
Serine (Ser, S)
n = 9 (5.23%)
Threonine (Thr, T)
n = 3 (1.74%)
Cysteine (Cys, C)
n = 7 (4.07%)
Valine (Val, V)
n = 42 (24.42%)
Leucine (Leu, L)
n = 17 (9.88%)
Isoleucine (Ile, I)
n = 13 (7.56%)
Methionine (Met, M)
n = 10 (5.81%)
Proline (Pro, P)
n = 3 (1.74%)
Phenylalanine (Phe, F)
n = 12 (6.98%)
Tyrosine (Tyr, Y)
n = 9 (5.23%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 6 (3.49%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 2 (1.16%)
Arginine (Arg, R)
n = 2 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 0 1 0 0 0 1 10 1 0 16 1 11 14 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 5 2 2 0 0 1 10 0 2 9 2 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 2 0 0 0 7 0 8 1 2 6 1 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 6 3 0 0 2 1 0 1 0 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 9 38 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 11 25 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 7 30 85
Total protein-coding genes (size: 11286 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 191 (5.08%)
Alanine (Ala, A)
n = 219 (5.83%)
Serine (Ser, S)
n = 298 (7.93%)
Threonine (Thr, T)
n = 368 (9.79%)
Cysteine (Cys, C)
n = 32 (0.85%)
Valine (Val, V)
n = 160 (4.26%)
Leucine (Leu, L)
n = 586 (15.59%)
Isoleucine (Ile, I)
n = 355 (9.44%)
Methionine (Met, M)
n = 260 (6.92%)
Proline (Pro, P)
n = 203 (5.4%)
Phenylalanine (Phe, F)
n = 207 (5.51%)
Tyrosine (Tyr, Y)
n = 116 (3.09%)
Tryptophan (Trp, W)
n = 99 (2.63%)
Aspartic acid (Asp, D)
n = 65 (1.73%)
Glutamic acid (Glu, E)
n = 98 (2.61%)
Asparagine (Asn, N)
n = 146 (3.88%)
Glutamine (Gln, Q)
n = 94 (2.5%)
Histidine (His, H)
n = 94 (2.5%)
Lysine (Lys, K)
n = 101 (2.69%)
Arginine (Arg, R)
n = 61 (1.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
167 188 230 116 87 236 17 119 88 6 46 30 63 21 98 109
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
30 16 16 49 77 86 7 43 49 65 34 54 49 93 7 93
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
136 134 5 52 73 121 2 16 34 55 61 6 11 47 99 32
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
62 78 20 34 31 90 11 11 14 33 3 1 2 4 0 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
733 908 1283 836
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
436 1038 718 1568
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
182 1115 1534 929

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.