Viewing data for Dasypus novemcinctus


Scientific name Dasypus novemcinctus
Common name Common long-nosed armadillo
Maximum lifespan 22.30 years (Dasypus novemcinctus@AnAge)

Total mtDNA (size: 17056 bases) GC AT G C A T
Base content (bases) 6628 10428 4452 2176 4554 5874
Base content per 1 kb (bases) 389 611 261 128 267 344
Base content (%) 38.9% 61.1%
Total protein-coding genes (size: 11336 bases) GC AT G C A T
Base content (bases) 4482 6854 3144 1338 3033 3821
Base content per 1 kb (bases) 395 605 277 118 268 337
Base content (%) 39.5% 60.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 580 931 342 238 399 532
Base content per 1 kb (bases) 384 616 226 158 264 352
Base content (%) 38.4% 61.6%
Total rRNA-coding genes (size: 2544 bases) GC AT G C A T
Base content (bases) 1017 1527 575 442 582 945
Base content per 1 kb (bases) 400 600 226 174 229 371
Base content (%) 40.0% 60.0%
12S rRNA gene (size: 966 bases) GC AT G C A T
Base content (bases) 392 574 222 170 224 350
Base content per 1 kb (bases) 406 594 230 176 232 362
Base content (%) 40.6% 59.4%
16S rRNA gene (size: 1578 bases) GC AT G C A T
Base content (bases) 625 953 353 272 358 595
Base content per 1 kb (bases) 396 604 224 172 227 377
Base content (%) 39.6% 60.4%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 271 410 198 73 175 235
Base content per 1 kb (bases) 398 602 291 107 257 345
Base content (%) 39.8% 60.2%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 67 137 52 15 57 80
Base content per 1 kb (bases) 328 672 255 74 279 392
Base content (%) 32.8% 67.2%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 657 885 406 251 428 457
Base content per 1 kb (bases) 426 574 263 163 278 296
Base content (%) 42.6% 57.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 269 415 182 87 174 241
Base content per 1 kb (bases) 393 607 266 127 254 352
Base content (%) 39.3% 60.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 336 448 220 116 223 225
Base content per 1 kb (bases) 429 571 281 148 284 287
Base content (%) 42.9% 57.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 478 662 328 150 303 359
Base content per 1 kb (bases) 419 581 288 132 266 315
Base content (%) 41.9% 58.1%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 393 564 275 118 255 309
Base content per 1 kb (bases) 411 589 287 123 266 323
Base content (%) 41.1% 58.9%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 363 681 276 87 273 408
Base content per 1 kb (bases) 348 652 264 83 261 391
Base content (%) 34.8% 65.2%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 136 210 94 42 95 115
Base content per 1 kb (bases) 393 607 272 121 275 332
Base content (%) 39.3% 60.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 522 856 385 137 373 483
Base content per 1 kb (bases) 379 621 279 99 271 351
Base content (%) 37.9% 62.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 114 183 76 38 88 95
Base content per 1 kb (bases) 384 616 256 128 296 320
Base content (%) 38.4% 61.6%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 692 1114 506 186 505 609
Base content per 1 kb (bases) 383 617 280 103 280 337
Base content (%) 38.3% 61.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 204 324 161 43 99 225
Base content per 1 kb (bases) 386 614 305 81 188 426
Base content (%) 38.6% 61.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 11 (4.87%)
Threonine (Thr, T)
n = 26 (11.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 36 (15.93%)
Isoleucine (Ile, I)
n = 30 (13.27%)
Methionine (Met, M)
n = 16 (7.08%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 2 (0.88%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 16 13 3 3 16 4 10 8 0 0 3 5 1 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 7 7 0 0 7 4 0 3 2 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 15 0 2 0 5 0 1 3 0 2 0 0 1 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 0 1 4 1 0 0 4 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 60 92 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 64 37 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 74 106 37
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIVSMLLSLFILMQLKFIKFSSFSTPCPTTMEKTKHLTPWEMKWTKTYLPHSLPLP*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 7 (10.45%)
Threonine (Thr, T)
n = 10 (14.93%)
Cysteine (Cys, C)
n = 1 (1.49%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 10 (14.93%)
Isoleucine (Ile, I)
n = 4 (5.97%)
Methionine (Met, M)
n = 5 (7.46%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 5 (7.46%)
Tyrosine (Tyr, Y)
n = 1 (1.49%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 2 (2.99%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 6 (8.96%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 3 0 0 8 0 1 2 0 0 0 1 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 0 0 0 0 0 0 0 0 3 1 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 1 0 1 4 1 0 1 1 0 0 1 0 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 5 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 19 26 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 23 15 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 10 39 13
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.16%)
Alanine (Ala, A)
n = 40 (7.8%)
Serine (Ser, S)
n = 29 (5.65%)
Threonine (Thr, T)
n = 37 (7.21%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.21%)
Leucine (Leu, L)
n = 62 (12.09%)
Isoleucine (Ile, I)
n = 38 (7.41%)
Methionine (Met, M)
n = 33 (6.43%)
Proline (Pro, P)
n = 29 (5.65%)
Phenylalanine (Phe, F)
n = 43 (8.38%)
Tyrosine (Tyr, Y)
n = 18 (3.51%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 16 (3.12%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.51%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 26 7 9 30 3 12 6 0 6 7 23 1 14 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 7 17 14 2 3 17 20 7 4 5 19 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 24 0 1 10 14 1 2 1 10 8 1 1 2 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 2 6 9 9 0 2 0 6 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 110 136 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 132 93 213
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 164 228 96
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 38 (16.74%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 13 4 4 21 1 7 5 1 2 4 5 1 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 1 2 6 0 3 1 3 1 3 3 8 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 0 2 4 8 0 0 4 5 5 0 1 2 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 13 1 3 9 5 0 1 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 64 63 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 62 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 64 116 41
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 6 7 2 2 21 1 6 6 1 2 3 9 2 9 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 5 5 5 1 4 11 5 0 3 3 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 11 1 3 3 10 0 0 5 2 9 1 0 2 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 0 1 2 2 1 1 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 67 59 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 88 111 53
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 5 (1.32%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 27 13 5 8 27 5 11 7 0 3 5 10 0 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 4 0 10 13 0 3 11 10 1 1 3 17 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 17 0 4 1 12 1 0 3 5 11 0 2 2 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 1 9 8 1 3 1 4 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 94 115 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 91 77 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 143 167 56
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 32 (10.06%)
Serine (Ser, S)
n = 20 (6.29%)
Threonine (Thr, T)
n = 23 (7.23%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.09%)
Leucine (Leu, L)
n = 59 (18.55%)
Isoleucine (Ile, I)
n = 25 (7.86%)
Methionine (Met, M)
n = 19 (5.97%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 19 (5.97%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 8 (2.52%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 5 (1.57%)
Histidine (His, H)
n = 6 (1.89%)
Lysine (Lys, K)
n = 8 (2.52%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 16 18 5 8 28 2 15 4 1 2 2 8 1 9 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 2 13 17 0 1 5 4 3 1 4 17 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 1 2 5 11 0 0 2 6 5 2 1 5 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 1 0 3 8 0 1 3 4 0 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 84 89 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 95 57 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 96 163 46
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 16 (4.61%)
Serine (Ser, S)
n = 26 (7.49%)
Threonine (Thr, T)
n = 44 (12.68%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 58 (16.71%)
Isoleucine (Ile, I)
n = 37 (10.66%)
Methionine (Met, M)
n = 41 (11.82%)
Proline (Pro, P)
n = 17 (4.9%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 12 (3.46%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 20 (5.76%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 21 36 7 10 30 1 10 10 0 1 0 3 2 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 1 7 7 1 1 4 9 1 1 5 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 32 2 3 4 17 0 1 1 5 7 1 0 6 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 2 0 0 11 0 0 0 3 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 83 155 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 101 63 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 92 190 50
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 16 (4.61%)
Serine (Ser, S)
n = 26 (7.49%)
Threonine (Thr, T)
n = 44 (12.68%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 58 (16.71%)
Isoleucine (Ile, I)
n = 37 (10.66%)
Methionine (Met, M)
n = 41 (11.82%)
Proline (Pro, P)
n = 17 (4.9%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 12 (3.46%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 20 (5.76%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 21 36 7 10 30 1 10 10 0 1 0 3 2 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 1 7 7 1 1 4 9 1 1 5 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 32 2 3 4 17 0 1 1 5 7 1 0 6 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 2 0 0 11 0 0 0 3 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 83 155 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 101 63 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 92 190 50
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 34 (7.42%)
Threonine (Thr, T)
n = 53 (11.57%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 91 (19.87%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 40 (8.73%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 15 (3.28%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 15 (3.28%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 19 36 10 11 48 5 16 10 1 0 2 7 0 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 3 12 12 1 4 7 5 1 3 8 10 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 32 2 4 9 12 0 2 7 9 8 0 1 3 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 0 1 2 12 3 0 3 7 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 127 175 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 127 80 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 131 228 81
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 3 (3.06%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 8 (8.16%)
Methionine (Met, M)
n = 15 (15.31%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 4 13 3 2 8 3 2 2 0 0 2 6 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 2 4 0 0 2 2 0 0 0 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 0 4 3 0 0 2 1 2 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 0 0 0 1 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 24 32 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 20 16 53
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 32 47 15
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.66%)
Alanine (Ala, A)
n = 38 (6.32%)
Serine (Ser, S)
n = 57 (9.48%)
Threonine (Thr, T)
n = 49 (8.15%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 15 (2.5%)
Leucine (Leu, L)
n = 93 (15.47%)
Isoleucine (Ile, I)
n = 60 (9.98%)
Methionine (Met, M)
n = 42 (6.99%)
Proline (Pro, P)
n = 31 (5.16%)
Phenylalanine (Phe, F)
n = 37 (6.16%)
Tyrosine (Tyr, Y)
n = 24 (3.99%)
Tryptophan (Trp, W)
n = 12 (2.0%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 8 (1.33%)
Asparagine (Asn, N)
n = 31 (5.16%)
Glutamine (Gln, Q)
n = 18 (3.0%)
Histidine (His, H)
n = 12 (2.0%)
Lysine (Lys, K)
n = 22 (3.66%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 28 39 12 13 45 6 16 16 2 3 0 10 2 16 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 5 3 18 16 1 4 9 15 0 7 7 16 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 24 0 4 12 30 1 4 6 10 14 2 1 8 23 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 1 2 8 19 3 1 3 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 146 214 143
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 165 126 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 195 269 115
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.57%)
Alanine (Ala, A)
n = 9 (5.14%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 5 (2.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 10 (5.71%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 6 (3.43%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (1.14%)
Arginine (Arg, R)
n = 3 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 4 0 0 0 0 12 0 0 15 1 5 4 9 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 0 7 0 0 2 11 3 6 9 1 1 0 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 6 1 1 0 3 1 8 1 3 9 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 5 4 2 1 1 3 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 6 37 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 25 27 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 12 35 88
Total protein-coding genes (size: 11391 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 221 (5.82%)
Alanine (Ala, A)
n = 246 (6.48%)
Serine (Ser, S)
n = 271 (7.14%)
Threonine (Thr, T)
n = 325 (8.56%)
Cysteine (Cys, C)
n = 26 (0.69%)
Valine (Val, V)
n = 172 (4.53%)
Leucine (Leu, L)
n = 602 (15.86%)
Isoleucine (Ile, I)
n = 342 (9.01%)
Methionine (Met, M)
n = 265 (6.98%)
Proline (Pro, P)
n = 201 (5.3%)
Phenylalanine (Phe, F)
n = 223 (5.88%)
Tyrosine (Tyr, Y)
n = 137 (3.61%)
Tryptophan (Trp, W)
n = 103 (2.71%)
Aspartic acid (Asp, D)
n = 67 (1.77%)
Glutamic acid (Glu, E)
n = 90 (2.37%)
Asparagine (Asn, N)
n = 144 (3.79%)
Glutamine (Gln, Q)
n = 85 (2.24%)
Histidine (His, H)
n = 100 (2.64%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
178 164 227 59 72 298 32 124 78 7 34 29 95 14 90 133
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 9 17 34 100 104 8 35 77 84 25 31 45 121 4 40
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
82 195 8 31 57 129 4 13 37 63 74 10 17 34 110 24
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 76 14 19 48 87 11 13 12 41 2 1 0 7 2 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
796 915 1225 860
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
469 993 730 1604
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
196 1133 1760 707

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.