Viewing data for Antilope cervicapra


Scientific name Antilope cervicapra
Common name Blackbuck
Maximum lifespan 23.90 years (Antilope cervicapra@AnAge)

Total mtDNA (size: 16431 bases) GC AT G C A T
Base content (bases) 6453 9978 4255 2198 4438 5540
Base content per 1 kb (bases) 393 607 259 134 270 337
Base content (%) 39.3% 60.7%
Total protein-coding genes (size: 11351 bases) GC AT G C A T
Base content (bases) 4518 6833 3146 1372 3133 3700
Base content per 1 kb (bases) 398 602 277 121 276 326
Base content (%) 39.8% 60.2%
D-loop (size: 998 bases) GC AT G C A T
Base content (bases) 400 598 247 153 274 324
Base content per 1 kb (bases) 401 599 247 153 275 325
Base content (%) 40.1% 59.9%
Total tRNA-coding genes (size: 1503 bases) GC AT G C A T
Base content (bases) 541 962 312 229 429 533
Base content per 1 kb (bases) 360 640 208 152 285 355
Base content (%) 36.0% 64.0%
Total rRNA-coding genes (size: 2527 bases) GC AT G C A T
Base content (bases) 972 1555 536 436 594 961
Base content per 1 kb (bases) 385 615 212 173 235 380
Base content (%) 38.5% 61.5%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 382 575 214 168 218 357
Base content per 1 kb (bases) 399 601 224 176 228 373
Base content (%) 39.9% 60.1%
16S rRNA gene (size: 1570 bases) GC AT G C A T
Base content (bases) 590 980 322 268 376 604
Base content per 1 kb (bases) 376 624 205 171 239 385
Base content (%) 37.6% 62.4%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 265 416 189 76 196 220
Base content per 1 kb (bases) 389 611 278 112 288 323
Base content (%) 38.9% 61.1%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 67 134 53 14 55 79
Base content per 1 kb (bases) 333 667 264 70 274 393
Base content (%) 33.3% 66.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 632 913 382 250 470 443
Base content per 1 kb (bases) 409 591 247 162 304 287
Base content (%) 40.9% 59.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 268 416 170 98 181 235
Base content per 1 kb (bases) 392 608 249 143 265 344
Base content (%) 39.2% 60.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 342 442 233 109 229 213
Base content per 1 kb (bases) 436 564 297 139 292 272
Base content (%) 43.6% 56.4%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 477 663 324 153 301 362
Base content per 1 kb (bases) 418 582 284 134 264 318
Base content (%) 41.8% 58.2%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 386 571 265 121 261 310
Base content per 1 kb (bases) 403 597 277 126 273 324
Base content (%) 40.3% 59.7%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 387 657 294 93 278 379
Base content per 1 kb (bases) 371 629 282 89 266 363
Base content (%) 37.1% 62.9%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 136 211 95 41 103 108
Base content per 1 kb (bases) 392 608 274 118 297 311
Base content (%) 39.2% 60.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 548 830 398 150 384 446
Base content per 1 kb (bases) 398 602 289 109 279 324
Base content (%) 39.8% 60.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 112 185 78 34 88 97
Base content per 1 kb (bases) 377 623 263 114 296 327
Base content (%) 37.7% 62.3%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 722 1108 522 200 499 609
Base content per 1 kb (bases) 395 605 285 109 273 333
Base content (%) 39.5% 60.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 197 331 157 40 110 221
Base content per 1 kb (bases) 373 627 297 76 208 419
Base content (%) 37.3% 62.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 11 9 10 2 23 1 7 9 0 2 1 8 1 8 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 7 6 1 0 4 7 0 5 4 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 1 4 1 4 0 0 5 2 0 0 2 2 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 1 0 4 0 1 1 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 68 78 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 62 38 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 59 104 56
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLVLFIIFQLKISKHSFYHNPEPSPTKTLKQNTPWETKWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (9.09%)
Threonine (Thr, T)
n = 8 (12.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 11 (16.67%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 3 (4.55%)
Proline (Pro, P)
n = 7 (10.61%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 2 2 1 5 1 0 3 0 1 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 1 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 6 1 0 0 5 0 0 1 1 1 1 2 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 6 0 0 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 21 25 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 20 19 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 12 35 14
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.95%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 20 (3.89%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 20 (3.89%)
Glutamine (Gln, Q)
n = 5 (0.97%)
Histidine (His, H)
n = 19 (3.7%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 7 (1.36%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 9 27 10 8 24 3 11 5 0 5 10 20 3 24 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 10 12 17 1 8 8 25 5 9 11 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 1 7 7 12 1 2 2 11 9 0 3 7 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 2 4 10 7 2 0 1 5 1 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 104 142 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 133 97 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 145 204 138
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 6 11 5 2 16 2 8 6 0 3 3 6 0 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 0 3 5 0 0 3 2 3 2 2 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 10 2 3 5 8 0 1 4 4 7 1 1 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 3 4 6 5 1 0 2 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 57 68 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 58 106 45
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 9 (3.46%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 7 8 7 9 9 1 6 7 0 4 7 5 0 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 2 6 7 0 6 8 5 1 3 5 4 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 0 3 4 8 0 0 4 5 6 0 0 2 7 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 0 0 3 2 0 0 2 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 67 62 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 57 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 101 94 62
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 19 (5.01%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 38 (10.03%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 22 12 9 11 27 3 6 5 1 1 10 8 0 10 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 2 7 17 0 1 5 16 2 2 4 15 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 18 0 1 6 13 0 2 1 4 11 0 1 4 14 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 2 9 8 1 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 98 113 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 94 77 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 132 172 61
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 24 (7.55%)
Threonine (Thr, T)
n = 23 (7.23%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 15 (4.72%)
Leucine (Leu, L)
n = 54 (16.98%)
Isoleucine (Ile, I)
n = 28 (8.81%)
Methionine (Met, M)
n = 19 (5.97%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 21 (6.6%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 11 (3.46%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 18 17 5 8 29 2 9 6 1 3 1 10 1 12 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 4 18 2 1 4 6 1 2 9 10 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 14 1 0 6 12 1 2 3 3 8 1 1 5 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 9 2 1 2 6 1 0 1 7 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 85 93 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 92 55 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 88 162 52
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 19 (5.48%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 38 (10.95%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 41 (11.82%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 20 34 5 12 27 2 10 9 1 2 6 4 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 3 9 7 0 1 3 10 0 2 4 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 20 0 3 10 13 0 0 2 1 7 0 1 3 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 1 2 12 0 0 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 82 145 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 101 59 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 111 175 50
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 19 (5.48%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 38 (10.95%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 41 (11.82%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 20 34 5 12 27 2 10 9 1 2 6 4 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 3 9 7 0 1 3 10 0 2 4 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 20 0 3 10 13 0 0 2 1 7 0 1 3 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 1 2 12 0 0 0 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 82 145 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 101 59 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 111 175 50
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 23 (5.02%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 23 29 12 15 45 5 13 9 2 0 7 8 1 14 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 2 4 7 15 0 2 7 7 2 3 9 7 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 23 1 2 18 8 1 3 8 5 12 1 2 6 17 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 0 0 3 11 0 1 2 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 128 159 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 113 84 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 157 203 76
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 12 0 5 9 1 6 2 0 0 1 4 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 0 3 4 0 0 1 2 1 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 1 4 4 0 1 0 1 3 0 1 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 21 30 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 34 50 10
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.6%)
Alanine (Ala, A)
n = 42 (6.9%)
Serine (Ser, S)
n = 48 (7.88%)
Threonine (Thr, T)
n = 57 (9.36%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 20 (3.28%)
Leucine (Leu, L)
n = 89 (14.61%)
Isoleucine (Ile, I)
n = 59 (9.69%)
Methionine (Met, M)
n = 40 (6.57%)
Proline (Pro, P)
n = 26 (4.27%)
Phenylalanine (Phe, F)
n = 46 (7.55%)
Tyrosine (Tyr, Y)
n = 19 (3.12%)
Tryptophan (Trp, W)
n = 12 (1.97%)
Aspartic acid (Asp, D)
n = 11 (1.81%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 34 (5.58%)
Glutamine (Gln, Q)
n = 18 (2.96%)
Histidine (His, H)
n = 12 (1.97%)
Lysine (Lys, K)
n = 24 (3.94%)
Arginine (Arg, R)
n = 8 (1.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 29 38 14 15 47 3 10 15 3 3 5 12 0 20 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 4 8 13 19 2 2 10 14 2 2 13 9 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 28 1 5 15 14 1 3 10 8 11 1 0 9 25 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 2 3 8 21 3 0 4 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
112 143 227 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 160 130 254
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 219 252 117
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 1 3 0 0 1 0 9 0 1 12 1 6 6 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 5 0 1 1 12 0 3 11 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 1 5 0 1 1 3 1 7 3 3 8 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 8 4 0 1 3 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 6 45 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 8 32 86
Total protein-coding genes (size: 11416 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.63%)
Alanine (Ala, A)
n = 248 (6.52%)
Serine (Ser, S)
n = 282 (7.42%)
Threonine (Thr, T)
n = 317 (8.34%)
Cysteine (Cys, C)
n = 23 (0.6%)
Valine (Val, V)
n = 195 (5.13%)
Leucine (Leu, L)
n = 598 (15.72%)
Isoleucine (Ile, I)
n = 323 (8.49%)
Methionine (Met, M)
n = 256 (6.73%)
Proline (Pro, P)
n = 191 (5.02%)
Phenylalanine (Phe, F)
n = 241 (6.34%)
Tyrosine (Tyr, Y)
n = 133 (3.5%)
Tryptophan (Trp, W)
n = 104 (2.73%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 164 (4.31%)
Glutamine (Gln, Q)
n = 88 (2.31%)
Histidine (His, H)
n = 96 (2.52%)
Lysine (Lys, K)
n = 97 (2.55%)
Arginine (Arg, R)
n = 62 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
170 153 208 85 93 271 26 101 79 9 37 52 93 13 129 112
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
48 6 17 43 78 120 7 33 53 100 28 38 64 83 6 50
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
85 173 9 36 77 104 5 17 43 54 79 9 22 46 118 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 77 18 20 47 86 11 3 14 44 1 1 0 8 1 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
819 912 1218 855
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
464 978 749 1613
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
213 1153 1643 795

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.