Viewing data for Ailurus fulgens


Scientific name Ailurus fulgens
Common name Lesser panda
Maximum lifespan 19.00 years (Ailurus fulgens@AnAge)

Total mtDNA (size: 16493 bases) GC AT G C A T
Base content (bases) 6204 10289 4001 2203 4863 5426
Base content per 1 kb (bases) 376 624 243 134 295 329
Base content (%) 37.6% 62.4%
Total protein-coding genes (size: 11341 bases) GC AT G C A T
Base content (bases) 4248 7093 2880 1368 3492 3601
Base content per 1 kb (bases) 375 625 254 121 308 318
Base content (%) 37.5% 62.5%
D-loop (size: 1048 bases) GC AT G C A T
Base content (bases) 423 625 270 153 294 331
Base content per 1 kb (bases) 404 596 258 146 281 316
Base content (%) 40.4% 59.6%
Total tRNA-coding genes (size: 1509 bases) GC AT G C A T
Base content (bases) 530 979 300 230 437 542
Base content per 1 kb (bases) 351 649 199 152 290 359
Base content (%) 35.1% 64.9%
Total rRNA-coding genes (size: 2540 bases) GC AT G C A T
Base content (bases) 980 1560 536 444 628 932
Base content per 1 kb (bases) 386 614 211 175 247 367
Base content (%) 38.6% 61.4%
12S rRNA gene (size: 965 bases) GC AT G C A T
Base content (bases) 380 585 214 166 231 354
Base content per 1 kb (bases) 394 606 222 172 239 367
Base content (%) 39.4% 60.6%
16S rRNA gene (size: 1575 bases) GC AT G C A T
Base content (bases) 600 975 322 278 397 578
Base content per 1 kb (bases) 381 619 204 177 252 367
Base content (%) 38.1% 61.9%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 255 426 180 75 213 213
Base content per 1 kb (bases) 374 626 264 110 313 313
Base content (%) 37.4% 62.6%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 64 140 53 11 58 82
Base content per 1 kb (bases) 314 686 260 54 284 402
Base content (%) 31.4% 68.6%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 591 954 338 253 512 442
Base content per 1 kb (bases) 383 617 219 164 331 286
Base content (%) 38.3% 61.7%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 264 420 167 97 202 218
Base content per 1 kb (bases) 386 614 244 142 295 319
Base content (%) 38.6% 61.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 323 461 202 121 244 217
Base content per 1 kb (bases) 412 588 258 154 311 277
Base content (%) 41.2% 58.8%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 466 674 319 147 332 342
Base content per 1 kb (bases) 409 591 280 129 291 300
Base content (%) 40.9% 59.1%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 374 583 263 111 285 298
Base content per 1 kb (bases) 391 609 275 116 298 311
Base content (%) 39.1% 60.9%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 353 691 259 94 319 372
Base content per 1 kb (bases) 338 662 248 90 306 356
Base content (%) 33.8% 66.2%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 128 218 89 39 110 108
Base content per 1 kb (bases) 370 630 257 113 318 312
Base content (%) 37.0% 63.0%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 514 864 363 151 434 430
Base content per 1 kb (bases) 373 627 263 110 315 312
Base content (%) 37.3% 62.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 97 200 64 33 108 92
Base content per 1 kb (bases) 327 673 215 111 364 310
Base content (%) 32.7% 67.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 658 1163 464 194 574 589
Base content per 1 kb (bases) 361 639 255 107 315 323
Base content (%) 36.1% 63.9%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 184 344 136 48 121 223
Base content per 1 kb (bases) 348 652 258 91 229 422
Base content (%) 34.8% 65.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 11 (4.87%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 5 9 5 6 20 3 11 7 1 3 1 6 1 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 7 4 0 1 3 6 1 6 1 3 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 4 2 5 0 1 4 2 2 0 0 3 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 3 1 0 0 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 63 80 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 61 39 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 56 94 67
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIMSVMLTLFIMFQLKILKSSFPNNPEPKPTPMLKTSMPWEKKWTKTYLPLSLPQH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (8.96%)
Threonine (Thr, T)
n = 8 (11.94%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 9 (13.43%)
Isoleucine (Ile, I)
n = 4 (5.97%)
Methionine (Met, M)
n = 6 (8.96%)
Proline (Pro, P)
n = 9 (13.43%)
Phenylalanine (Phe, F)
n = 4 (5.97%)
Tyrosine (Tyr, Y)
n = 1 (1.49%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 2 (2.99%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 5 3 0 2 0 3 3 0 0 0 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 2 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 1 1 2 2 0 0 1 1 0 0 1 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 1 0 7 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 28 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 22 18 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 13 36 16
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 38 (7.39%)
Serine (Ser, S)
n = 33 (6.42%)
Threonine (Thr, T)
n = 36 (7.0%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.59%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 35 (6.81%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 18 26 13 3 16 5 20 4 2 11 3 24 1 21 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 11 8 18 1 11 7 23 6 15 7 6 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 18 0 6 9 13 2 2 1 15 4 0 1 11 6 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 1 10 5 9 0 2 1 5 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 97 138 131
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 132 95 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 109 209 169
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 35 (15.42%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 6 (2.64%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 11 10 4 4 15 1 7 5 2 2 3 6 0 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 3 3 3 0 1 2 4 1 7 2 4 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 2 7 6 0 1 4 8 2 1 4 2 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 13 2 5 5 4 1 1 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 58 66 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 54 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 55 91 65
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 7 9 5 4 13 1 9 7 0 2 4 8 2 12 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 5 5 3 1 2 6 9 4 2 4 5 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 4 6 5 1 2 2 9 3 1 2 3 5 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 2 3 0 1 0 1 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 62 62 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 75 100 71
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 22 (5.8%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 11 (2.9%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 49 (12.93%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 29 9 7 9 27 6 9 5 1 2 2 5 2 5 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 5 8 8 1 4 6 14 1 5 7 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 0 4 6 10 0 0 3 10 5 1 2 3 15 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 2 6 4 9 0 0 1 7 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 98 121 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 93 76 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 128 145 87
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 20 (6.29%)
Threonine (Thr, T)
n = 24 (7.55%)
Cysteine (Cys, C)
n = 3 (0.94%)
Valine (Val, V)
n = 13 (4.09%)
Leucine (Leu, L)
n = 53 (16.67%)
Isoleucine (Ile, I)
n = 30 (9.43%)
Methionine (Met, M)
n = 21 (6.6%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 21 (6.6%)
Tyrosine (Tyr, Y)
n = 10 (3.14%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 16 17 5 6 28 0 14 6 0 3 3 6 1 12 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 7 11 10 0 3 4 6 0 3 10 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 11 1 3 4 10 1 1 1 4 6 1 0 7 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 0 3 7 0 0 4 4 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 79 96 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 92 54 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 92 148 71
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 16 (4.61%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 32 (9.22%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 55 (15.85%)
Isoleucine (Ile, I)
n = 37 (10.66%)
Methionine (Met, M)
n = 44 (12.68%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 12 (3.46%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 20 39 6 11 22 2 14 8 1 3 1 3 1 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 3 11 0 2 5 7 2 8 5 9 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 9 2 9 4 13 0 1 1 6 6 1 0 7 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 2 0 0 14 0 0 0 2 1 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 80 146 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 96 63 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 83 163 84
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 16 (4.61%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 32 (9.22%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 55 (15.85%)
Isoleucine (Ile, I)
n = 37 (10.66%)
Methionine (Met, M)
n = 44 (12.68%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 12 (3.46%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 17 (4.9%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 14 (4.03%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 20 39 6 11 22 2 14 8 1 3 1 3 1 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 3 11 0 2 5 7 2 8 5 9 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 9 2 9 4 13 0 1 1 6 6 1 0 7 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 2 0 0 14 0 0 0 2 1 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 80 146 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 96 63 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 83 163 84
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 36 (7.86%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 45 (9.83%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 18 (3.93%)
Tyrosine (Tyr, Y)
n = 20 (4.37%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 20 (4.37%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 8 (1.75%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 17 30 21 8 43 1 20 11 0 1 1 5 2 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 6 14 13 3 3 3 10 1 10 10 1 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 2 6 12 9 0 2 10 10 10 1 2 13 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 4 2 2 11 2 1 2 7 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 123 160 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 119 84 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 121 186 129
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 8 (8.16%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 4 9 1 2 8 0 8 2 0 1 2 3 0 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 4 1 2 0 1 1 2 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 2 3 3 0 2 0 2 2 0 2 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 17 30 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 21 17 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 26 45 25
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 37 (6.11%)
Serine (Ser, S)
n = 46 (7.59%)
Threonine (Thr, T)
n = 61 (10.07%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 16 (2.64%)
Leucine (Leu, L)
n = 91 (15.02%)
Isoleucine (Ile, I)
n = 58 (9.57%)
Methionine (Met, M)
n = 42 (6.93%)
Proline (Pro, P)
n = 27 (4.46%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 19 (3.14%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 32 (5.28%)
Glutamine (Gln, Q)
n = 20 (3.3%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 23 39 15 16 35 4 20 19 1 3 3 9 1 26 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 3 14 13 6 4 5 8 14 1 9 8 10 0 21
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 21 1 8 9 15 2 4 8 10 9 1 1 15 17 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 4 5 4 20 3 1 3 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 138 228 139
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 159 128 254
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 167 233 181
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.71%)
Alanine (Ala, A)
n = 9 (5.14%)
Serine (Ser, S)
n = 14 (8.0%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 2 6 3 1 0 1 12 0 1 13 2 5 2 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 6 1 1 1 8 0 9 7 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 1 4 0 2 2 6 0 8 1 2 4 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 5 5 0 2 2 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 10 45 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 28 31 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 10 45 90
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 239 (6.29%)
Serine (Ser, S)
n = 281 (7.39%)
Threonine (Thr, T)
n = 316 (8.31%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 167 (4.39%)
Leucine (Leu, L)
n = 602 (15.84%)
Isoleucine (Ile, I)
n = 352 (9.26%)
Methionine (Met, M)
n = 256 (6.74%)
Proline (Pro, P)
n = 197 (5.18%)
Phenylalanine (Phe, F)
n = 238 (6.26%)
Tyrosine (Tyr, Y)
n = 138 (3.63%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 64 (1.68%)
Glutamic acid (Glu, E)
n = 98 (2.58%)
Asparagine (Asn, N)
n = 154 (4.05%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 92 (2.42%)
Lysine (Lys, K)
n = 99 (2.6%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
195 157 212 92 73 243 24 151 79 9 46 26 82 13 129 109
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
44 10 16 70 75 83 11 41 46 105 25 73 61 62 1 102
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
81 124 9 53 68 93 8 24 35 88 50 9 19 72 82 48
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
44 75 23 38 26 90 9 8 13 42 1 1 0 8 1 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
785 873 1237 907
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
471 974 742 1615
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
206 962 1545 1089

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.