Viewing data for Dermophis mexicanus


Scientific name Dermophis mexicanus
Common name Mexican burrowing caecilian
Maximum lifespan 13.80 years (Dermophis mexicanus@AnAge)

Total mtDNA (size: 16162 bases) GC AT G C A T
Base content (bases) 5111 11051 3263 1848 5084 5967
Base content per 1 kb (bases) 316 684 202 114 315 369
Base content (%) 31.6% 68.4%
Total protein-coding genes (size: 11281 bases) GC AT G C A T
Base content (bases) 3563 7718 2338 1225 3648 4070
Base content per 1 kb (bases) 316 684 207 109 323 361
Base content (%) 31.6% 68.4%
D-loop (size: 630 bases) GC AT G C A T
Base content (bases) 185 445 121 64 236 209
Base content per 1 kb (bases) 294 706 192 102 375 332
Base content (%) 29.4% 70.6%
Total tRNA-coding genes (size: 1534 bases) GC AT G C A T
Base content (bases) 482 1052 296 186 461 591
Base content per 1 kb (bases) 314 686 193 121 301 385
Base content (%) 31.4% 68.6%
Total rRNA-coding genes (size: 2519 bases) GC AT G C A T
Base content (bases) 843 1676 484 359 663 1013
Base content per 1 kb (bases) 335 665 192 143 263 402
Base content (%) 33.5% 66.5%
12S rRNA gene (size: 943 bases) GC AT G C A T
Base content (bases) 335 608 199 136 252 356
Base content per 1 kb (bases) 355 645 211 144 267 378
Base content (%) 35.5% 64.5%
16S rRNA gene (size: 1576 bases) GC AT G C A T
Base content (bases) 508 1068 285 223 411 657
Base content per 1 kb (bases) 322 678 181 141 261 417
Base content (%) 32.2% 67.8%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 207 477 148 59 234 243
Base content per 1 kb (bases) 303 697 216 86 342 355
Base content (%) 30.3% 69.7%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 41 124 35 6 43 81
Base content per 1 kb (bases) 248 752 212 36 261 491
Base content (%) 24.8% 75.2%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 528 1026 290 238 543 483
Base content per 1 kb (bases) 340 660 187 153 349 311
Base content (%) 34.0% 66.0%
COX2 (size: 689 bases) GC AT G C A T
Base content (bases) 229 460 144 85 209 251
Base content per 1 kb (bases) 332 668 209 123 303 364
Base content (%) 33.2% 66.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 274 510 159 115 268 242
Base content per 1 kb (bases) 349 651 203 147 342 309
Base content (%) 34.9% 65.1%
CYTB (size: 1138 bases) GC AT G C A T
Base content (bases) 382 756 258 124 369 387
Base content per 1 kb (bases) 336 664 227 109 324 340
Base content (%) 33.6% 66.4%
ND1 (size: 963 bases) GC AT G C A T
Base content (bases) 296 667 195 101 314 353
Base content per 1 kb (bases) 307 693 202 105 326 367
Base content (%) 30.7% 69.3%
ND2 (size: 1036 bases) GC AT G C A T
Base content (bases) 308 728 223 85 321 407
Base content per 1 kb (bases) 297 703 215 82 310 393
Base content (%) 29.7% 70.3%
ND3 (size: 344 bases) GC AT G C A T
Base content (bases) 114 230 77 37 110 120
Base content per 1 kb (bases) 331 669 224 108 320 349
Base content (%) 33.1% 66.9%
ND4 (size: 1372 bases) GC AT G C A T
Base content (bases) 411 961 291 120 465 496
Base content per 1 kb (bases) 300 700 212 87 339 362
Base content (%) 30.0% 70.0%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 102 189 65 37 95 94
Base content per 1 kb (bases) 351 649 223 127 326 323
Base content (%) 35.1% 64.9%
ND5 (size: 1782 bases) GC AT G C A T
Base content (bases) 507 1275 334 173 591 684
Base content per 1 kb (bases) 285 715 187 97 332 384
Base content (%) 28.5% 71.5%
ND6 (size: 494 bases) GC AT G C A T
Base content (bases) 166 328 120 46 89 239
Base content per 1 kb (bases) 336 664 243 93 180 484
Base content (%) 33.6% 66.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 51 (22.47%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 20 (8.81%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 13 (5.73%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 2 (0.88%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 5 19 7 3 13 0 26 10 0 2 0 6 0 10 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 5 6 0 2 2 3 1 2 0 14 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 10 0 0 1 6 0 1 3 3 2 0 2 6 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 1 3 0 0 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 55 80 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 61 35 112
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 32 128 64
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPHPWFMIMMMLWTITLTMILTKMTKYKSTNMITQNSMHKQHQSWTWPWQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.56%)
Threonine (Thr, T)
n = 8 (14.81%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 4 (7.41%)
Isoleucine (Ile, I)
n = 4 (7.41%)
Methionine (Met, M)
n = 9 (16.67%)
Proline (Pro, P)
n = 4 (7.41%)
Phenylalanine (Phe, F)
n = 1 (1.85%)
Tyrosine (Tyr, Y)
n = 1 (1.85%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.56%)
Glutamine (Gln, Q)
n = 5 (9.26%)
Histidine (His, H)
n = 3 (5.56%)
Lysine (Lys, K)
n = 4 (7.41%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 8 0 0 1 0 3 5 0 0 0 0 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 0 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 1 0 2 0 0 0 1 0 0 0 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
0 13 28 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 15 17 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 7 36 11
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.9%)
Alanine (Ala, A)
n = 41 (7.93%)
Serine (Ser, S)
n = 33 (6.38%)
Threonine (Thr, T)
n = 37 (7.16%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.77%)
Leucine (Leu, L)
n = 56 (10.83%)
Isoleucine (Ile, I)
n = 47 (9.09%)
Methionine (Met, M)
n = 30 (5.8%)
Proline (Pro, P)
n = 27 (5.22%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 20 (3.87%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 13 (2.51%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 17 (3.29%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 18 (3.48%)
Lysine (Lys, K)
n = 10 (1.93%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 12 28 6 3 11 0 35 9 0 8 0 26 1 31 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 18 8 14 1 20 5 17 4 4 1 21 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 20 0 5 5 17 0 4 2 15 5 3 1 11 6 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 0 10 3 10 0 4 0 4 0 0 0 0 1 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 82 147 143
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 132 99 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 76 237 191
COX2 (size: 689 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 11 (4.82%)
Serine (Ser, S)
n = 16 (7.02%)
Threonine (Thr, T)
n = 24 (10.53%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.7%)
Leucine (Leu, L)
n = 23 (10.09%)
Isoleucine (Ile, I)
n = 23 (10.09%)
Methionine (Met, M)
n = 17 (7.46%)
Proline (Pro, P)
n = 13 (5.7%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 12 (5.26%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 6 (2.63%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 8 (3.51%)
Lysine (Lys, K)
n = 5 (2.19%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 5 16 3 3 3 1 13 8 0 4 2 7 0 8 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 2 4 5 0 2 1 5 0 1 2 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 0 3 2 8 1 0 2 8 0 1 0 4 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 1 8 4 5 0 1 1 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 45 77 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 62 60 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 37 113 74
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 11 (4.23%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 13 (5.0%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 3 11 4 1 6 0 19 7 0 9 1 8 0 12 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 8 7 6 0 6 2 10 0 2 1 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 16 0 2 0 11 0 1 2 8 5 0 1 3 2 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 1 5 0 3 0 2 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 48 60 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 67 55 99
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 44 127 86
CYTB (size: 1138 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.61%)
Alanine (Ala, A)
n = 21 (5.56%)
Serine (Ser, S)
n = 25 (6.61%)
Threonine (Thr, T)
n = 25 (6.61%)
Cysteine (Cys, C)
n = 1 (0.26%)
Valine (Val, V)
n = 13 (3.44%)
Leucine (Leu, L)
n = 55 (14.55%)
Isoleucine (Ile, I)
n = 37 (9.79%)
Methionine (Met, M)
n = 24 (6.35%)
Proline (Pro, P)
n = 21 (5.56%)
Phenylalanine (Phe, F)
n = 32 (8.47%)
Tyrosine (Tyr, Y)
n = 15 (3.97%)
Tryptophan (Trp, W)
n = 10 (2.65%)
Aspartic acid (Asp, D)
n = 7 (1.85%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 24 (6.35%)
Glutamine (Gln, Q)
n = 8 (2.12%)
Histidine (His, H)
n = 13 (3.44%)
Lysine (Lys, K)
n = 9 (2.38%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 13 23 7 2 20 0 26 7 1 3 2 8 0 19 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 6 11 0 5 7 13 0 2 0 17 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 0 4 4 14 0 1 2 8 7 0 0 10 14 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 0 4 3 9 0 1 0 5 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 78 122 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 89 83 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 91 182 101
ND1 (size: 963 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 22 (6.88%)
Serine (Ser, S)
n = 23 (7.19%)
Threonine (Thr, T)
n = 27 (8.44%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 10 (3.13%)
Leucine (Leu, L)
n = 54 (16.88%)
Isoleucine (Ile, I)
n = 28 (8.75%)
Methionine (Met, M)
n = 29 (9.06%)
Proline (Pro, P)
n = 22 (6.88%)
Phenylalanine (Phe, F)
n = 16 (5.0%)
Tyrosine (Tyr, Y)
n = 12 (3.75%)
Tryptophan (Trp, W)
n = 7 (2.19%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 11 (3.44%)
Asparagine (Asn, N)
n = 14 (4.38%)
Glutamine (Gln, Q)
n = 8 (2.5%)
Histidine (His, H)
n = 1 (0.31%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 8 (2.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 7 28 7 2 15 0 29 8 0 2 1 7 0 9 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 6 2 14 0 6 2 7 1 5 1 16 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 16 1 3 3 15 1 0 1 12 0 0 1 8 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 0 4 0 7 0 0 0 8 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 63 106 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 93 58 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 39 189 88
ND2 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.07%)
Alanine (Ala, A)
n = 20 (5.81%)
Serine (Ser, S)
n = 23 (6.69%)
Threonine (Thr, T)
n = 45 (13.08%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 61 (17.73%)
Isoleucine (Ile, I)
n = 37 (10.76%)
Methionine (Met, M)
n = 37 (10.76%)
Proline (Pro, P)
n = 19 (5.52%)
Phenylalanine (Phe, F)
n = 12 (3.49%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 11 (3.2%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.03%)
Asparagine (Asn, N)
n = 14 (4.07%)
Glutamine (Gln, Q)
n = 10 (2.91%)
Histidine (His, H)
n = 8 (2.33%)
Lysine (Lys, K)
n = 11 (3.2%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 14 35 4 4 12 1 39 10 0 1 0 3 0 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 4 9 1 5 4 5 0 1 2 16 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 26 0 3 0 16 1 1 2 7 0 0 1 4 10 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 1 0 1 11 0 1 0 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 62 147 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 104 58 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 57 202 79
ND3 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.07%)
Alanine (Ala, A)
n = 20 (5.81%)
Serine (Ser, S)
n = 23 (6.69%)
Threonine (Thr, T)
n = 45 (13.08%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 61 (17.73%)
Isoleucine (Ile, I)
n = 37 (10.76%)
Methionine (Met, M)
n = 37 (10.76%)
Proline (Pro, P)
n = 19 (5.52%)
Phenylalanine (Phe, F)
n = 12 (3.49%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 11 (3.2%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.03%)
Asparagine (Asn, N)
n = 14 (4.07%)
Glutamine (Gln, Q)
n = 10 (2.91%)
Histidine (His, H)
n = 8 (2.33%)
Lysine (Lys, K)
n = 11 (3.2%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 14 35 4 4 12 1 39 10 0 1 0 3 0 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 4 9 1 5 4 5 0 1 2 16 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 26 0 3 0 16 1 1 2 7 0 0 1 4 10 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 1 0 1 11 0 1 0 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 62 147 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 104 58 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 57 202 79
ND4 (size: 1372 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.17%)
Alanine (Ala, A)
n = 20 (4.39%)
Serine (Ser, S)
n = 32 (7.02%)
Threonine (Thr, T)
n = 53 (11.62%)
Cysteine (Cys, C)
n = 5 (1.1%)
Valine (Val, V)
n = 7 (1.54%)
Leucine (Leu, L)
n = 73 (16.01%)
Isoleucine (Ile, I)
n = 53 (11.62%)
Methionine (Met, M)
n = 44 (9.65%)
Proline (Pro, P)
n = 23 (5.04%)
Phenylalanine (Phe, F)
n = 20 (4.39%)
Tyrosine (Tyr, Y)
n = 15 (3.29%)
Tryptophan (Trp, W)
n = 16 (3.51%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 20 (4.39%)
Glutamine (Gln, Q)
n = 14 (3.07%)
Histidine (His, H)
n = 12 (2.63%)
Lysine (Lys, K)
n = 9 (1.97%)
Arginine (Arg, R)
n = 11 (2.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 19 42 10 2 17 0 44 13 1 1 0 6 0 19 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 3 5 10 5 0 6 2 9 2 3 2 18 0 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 20 0 5 5 15 1 5 1 12 3 0 0 9 11 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 0 1 1 9 0 2 2 7 0 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 89 185 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 122 81 197
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 80 230 141
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.25%)
Alanine (Ala, A)
n = 7 (7.29%)
Serine (Ser, S)
n = 13 (13.54%)
Threonine (Thr, T)
n = 11 (11.46%)
Cysteine (Cys, C)
n = 3 (3.13%)
Valine (Val, V)
n = 4 (4.17%)
Leucine (Leu, L)
n = 20 (20.83%)
Isoleucine (Ile, I)
n = 5 (5.21%)
Methionine (Met, M)
n = 9 (9.38%)
Proline (Pro, P)
n = 2 (2.08%)
Phenylalanine (Phe, F)
n = 3 (3.13%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.04%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 1 (1.04%)
Glutamine (Gln, Q)
n = 1 (1.04%)
Histidine (His, H)
n = 4 (4.17%)
Lysine (Lys, K)
n = 1 (1.04%)
Arginine (Arg, R)
n = 2 (2.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 8 5 1 2 0 12 1 0 2 0 2 0 3 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 0 0 6 1 0 2 1 3 0 0 0 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 8 0 1 2 6 0 2 2 0 0 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 1 0 1 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 17 31 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 29 11 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 19 52 25
ND5 (size: 1782 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (5.06%)
Alanine (Ala, A)
n = 34 (5.73%)
Serine (Ser, S)
n = 48 (8.09%)
Threonine (Thr, T)
n = 53 (8.94%)
Cysteine (Cys, C)
n = 7 (1.18%)
Valine (Val, V)
n = 16 (2.7%)
Leucine (Leu, L)
n = 74 (12.48%)
Isoleucine (Ile, I)
n = 60 (10.12%)
Methionine (Met, M)
n = 52 (8.77%)
Proline (Pro, P)
n = 24 (4.05%)
Phenylalanine (Phe, F)
n = 41 (6.91%)
Tyrosine (Tyr, Y)
n = 14 (2.36%)
Tryptophan (Trp, W)
n = 14 (2.36%)
Aspartic acid (Asp, D)
n = 11 (1.85%)
Glutamic acid (Glu, E)
n = 11 (1.85%)
Asparagine (Asn, N)
n = 38 (6.41%)
Glutamine (Gln, Q)
n = 24 (4.05%)
Histidine (His, H)
n = 8 (1.35%)
Lysine (Lys, K)
n = 26 (4.38%)
Arginine (Arg, R)
n = 8 (1.35%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
44 16 50 7 3 16 0 48 24 0 5 1 10 0 27 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 5 2 6 12 16 0 6 3 21 0 2 1 21 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 31 0 13 3 25 0 3 4 12 2 1 0 22 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 10 1 9 2 25 1 2 2 4 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 90 236 166
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 152 133 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 92 315 182
ND6 (size: 494 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (11.66%)
Alanine (Ala, A)
n = 12 (7.36%)
Serine (Ser, S)
n = 12 (7.36%)
Threonine (Thr, T)
n = 4 (2.45%)
Cysteine (Cys, C)
n = 3 (1.84%)
Valine (Val, V)
n = 24 (14.72%)
Leucine (Leu, L)
n = 25 (15.34%)
Isoleucine (Ile, I)
n = 9 (5.52%)
Methionine (Met, M)
n = 11 (6.75%)
Proline (Pro, P)
n = 4 (2.45%)
Phenylalanine (Phe, F)
n = 13 (7.98%)
Tyrosine (Tyr, Y)
n = 10 (6.13%)
Tryptophan (Trp, W)
n = 6 (3.68%)
Aspartic acid (Asp, D)
n = 3 (1.84%)
Glutamic acid (Glu, E)
n = 3 (1.84%)
Asparagine (Asn, N)
n = 4 (2.45%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (1.23%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 0 7 3 0 2 1 9 0 0 17 0 5 2 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 8 0 3 1 13 0 2 4 3 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 6 1 4 0 1 0 9 1 4 10 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 1 3 0 0 0 0 0 1 1 0 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 12 29 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 31 20 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 3 39 94
Total protein-coding genes (size: 11296 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.69%)
Alanine (Ala, A)
n = 230 (6.12%)
Serine (Ser, S)
n = 265 (7.05%)
Threonine (Thr, T)
n = 345 (9.17%)
Cysteine (Cys, C)
n = 26 (0.69%)
Valine (Val, V)
n = 153 (4.07%)
Leucine (Leu, L)
n = 552 (14.68%)
Isoleucine (Ile, I)
n = 349 (9.28%)
Methionine (Met, M)
n = 298 (7.92%)
Proline (Pro, P)
n = 194 (5.16%)
Phenylalanine (Phe, F)
n = 231 (6.14%)
Tyrosine (Tyr, Y)
n = 122 (3.24%)
Tryptophan (Trp, W)
n = 111 (2.95%)
Aspartic acid (Asp, D)
n = 62 (1.65%)
Glutamic acid (Glu, E)
n = 93 (2.47%)
Asparagine (Asn, N)
n = 157 (4.17%)
Glutamine (Gln, Q)
n = 107 (2.84%)
Histidine (His, H)
n = 90 (2.39%)
Lysine (Lys, K)
n = 90 (2.39%)
Arginine (Arg, R)
n = 67 (1.78%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
252 97 278 66 24 127 4 315 105 2 54 7 89 3 167 64
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
20 18 8 66 64 97 3 74 30 98 12 27 11 152 4 84
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
77 182 2 46 27 146 4 20 22 95 27 9 16 82 75 51
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
39 88 5 46 16 89 1 13 6 46 2 0 0 5 1 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
752 679 1281 1050
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
460 992 727 1583
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
88 594 1919 1161

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.