Viewing data for Bombina variegata


Scientific name Bombina variegata
Common name Yellow-bellied toad
Maximum lifespan 29.00 years (Bombina variegata@AnAge)

Total mtDNA (size: 18551 bases) GC AT G C A T
Base content (bases) 7803 10748 4837 2966 5179 5569
Base content per 1 kb (bases) 421 579 261 160 279 300
Base content (%) 42.1% 57.9%
Total protein-coding genes (size: 11342 bases) GC AT G C A T
Base content (bases) 4935 6407 3247 1688 3168 3239
Base content per 1 kb (bases) 435 565 286 149 279 286
Base content (%) 43.5% 56.5%
D-loop (size: 3076 bases) GC AT G C A T
Base content (bases) 1035 2041 556 479 1058 983
Base content per 1 kb (bases) 336 664 181 156 344 320
Base content (%) 33.6% 66.4%
Total tRNA-coding genes (size: 1533 bases) GC AT G C A T
Base content (bases) 683 850 387 296 381 469
Base content per 1 kb (bases) 446 554 252 193 249 306
Base content (%) 44.6% 55.4%
Total rRNA-coding genes (size: 2534 bases) GC AT G C A T
Base content (bases) 1118 1416 629 489 552 864
Base content per 1 kb (bases) 441 559 248 193 218 341
Base content (%) 44.1% 55.9%
12S rRNA gene (size: 933 bases) GC AT G C A T
Base content (bases) 440 493 252 188 190 303
Base content per 1 kb (bases) 472 528 270 202 204 325
Base content (%) 47.2% 52.8%
16S rRNA gene (size: 1601 bases) GC AT G C A T
Base content (bases) 678 923 377 301 362 561
Base content per 1 kb (bases) 423 577 235 188 226 350
Base content (%) 42.3% 57.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 282 402 196 86 213 189
Base content per 1 kb (bases) 412 588 287 126 311 276
Base content (%) 41.2% 58.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 67 101 51 16 39 62
Base content per 1 kb (bases) 399 601 304 95 232 369
Base content (%) 39.9% 60.1%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 702 852 400 302 463 389
Base content per 1 kb (bases) 452 548 257 194 298 250
Base content (%) 45.2% 54.8%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 290 398 181 109 174 224
Base content per 1 kb (bases) 422 578 263 158 253 326
Base content (%) 42.2% 57.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 366 418 227 139 220 198
Base content per 1 kb (bases) 467 533 290 177 281 253
Base content (%) 46.7% 53.3%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 506 635 340 166 329 306
Base content per 1 kb (bases) 443 557 298 145 288 268
Base content (%) 44.3% 55.7%
ND1 (size: 963 bases) GC AT G C A T
Base content (bases) 411 552 269 142 294 258
Base content per 1 kb (bases) 427 573 279 147 305 268
Base content (%) 42.7% 57.3%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 448 597 325 123 266 331
Base content per 1 kb (bases) 429 571 311 118 255 317
Base content (%) 42.9% 57.1%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 139 204 86 53 116 88
Base content per 1 kb (bases) 405 595 251 155 338 257
Base content (%) 40.5% 59.5%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 592 786 405 187 390 396
Base content per 1 kb (bases) 430 570 294 136 283 287
Base content (%) 43.0% 57.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 149 148 97 52 84 64
Base content per 1 kb (bases) 502 498 327 175 283 215
Base content (%) 50.2% 49.8%
ND5 (size: 1809 bases) GC AT G C A T
Base content (bases) 755 1054 509 246 517 537
Base content per 1 kb (bases) 417 583 281 136 286 297
Base content (%) 41.7% 58.3%
ND6 (size: 510 bases) GC AT G C A T
Base content (bases) 234 276 165 69 69 207
Base content per 1 kb (bases) 459 541 324 135 135 406
Base content (%) 45.9% 54.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 51 (22.47%)
Isoleucine (Ile, I)
n = 26 (11.45%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 13 (5.73%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 7 4 15 10 10 3 12 7 1 3 1 7 1 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 3 7 6 0 2 3 4 1 2 6 8 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 1 0 3 3 1 3 3 2 1 0 1 2 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 1 0 2 0 1 1 1 2 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 71 73 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 59 33 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 66 83 61
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPGPWFAILIFSWLILLTIFPQKVTKHLSMNEPATQNTEKSKPTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 1 0 3 1 0 2 2 1 0 0 1 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 0 0 0 0 1 0 0 1 0 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 1 0 2 0 0 0 0 0 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 16 20 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 20 14 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 15 28 9
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 43 (8.32%)
Serine (Ser, S)
n = 29 (5.61%)
Threonine (Thr, T)
n = 42 (8.12%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.74%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 37 (7.16%)
Methionine (Met, M)
n = 28 (5.42%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 40 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 9 11 16 7 10 14 9 3 4 10 8 18 4 20 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
17 0 1 8 20 14 1 5 17 18 7 8 9 8 3 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 23 1 7 3 13 2 0 4 6 13 1 6 7 8 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 6 5 10 8 0 3 1 3 2 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
156 110 134 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 95 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
68 152 160 138
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 19 (8.33%)
Serine (Ser, S)
n = 15 (6.58%)
Threonine (Thr, T)
n = 18 (7.89%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.14%)
Leucine (Leu, L)
n = 24 (10.53%)
Isoleucine (Ile, I)
n = 20 (8.77%)
Methionine (Met, M)
n = 15 (6.58%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 7 (3.07%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 11 (4.82%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 7 (3.07%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 8 (3.51%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 8 12 3 3 6 3 9 7 1 5 4 4 1 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 2 6 10 1 0 3 4 1 2 2 8 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 3 1 7 0 0 4 4 3 1 0 2 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 5 3 8 4 0 0 4 2 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 51 68 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 62 59 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 68 97 46
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 18 (6.92%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 6 6 7 8 11 2 5 7 1 4 4 8 1 13 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 10 8 1 1 11 6 3 2 3 4 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 9 1 3 3 5 0 0 4 2 9 1 1 0 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 4 0 4 2 1 1 2 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 67 55 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 64 54 99
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 96 89 55
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 23 (6.07%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 38 (10.03%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 34 (8.97%)
Tyrosine (Tyr, Y)
n = 12 (3.17%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 19 (5.01%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 23 9 13 12 18 3 10 6 1 4 8 4 1 14 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 5 12 10 1 2 9 13 3 0 10 11 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 1 2 4 11 4 0 2 4 8 1 3 6 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 2 1 8 8 1 1 2 4 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 95 102 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 95 73 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 150 131 73
ND1 (size: 963 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 28 (8.75%)
Serine (Ser, S)
n = 23 (7.19%)
Threonine (Thr, T)
n = 22 (6.88%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 16 (5.0%)
Leucine (Leu, L)
n = 56 (17.5%)
Isoleucine (Ile, I)
n = 30 (9.38%)
Methionine (Met, M)
n = 15 (4.69%)
Proline (Pro, P)
n = 20 (6.25%)
Phenylalanine (Phe, F)
n = 21 (6.56%)
Tyrosine (Tyr, Y)
n = 12 (3.75%)
Tryptophan (Trp, W)
n = 9 (2.81%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.44%)
Asparagine (Asn, N)
n = 11 (3.44%)
Glutamine (Gln, Q)
n = 8 (2.5%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 8 (2.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 11 11 6 14 17 7 8 6 2 7 2 4 3 12 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 5 17 5 1 2 4 8 2 2 3 14 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 7 0 5 7 8 0 0 3 6 6 1 4 8 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 5 1 2 7 0 0 3 5 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 83 88 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 90 56 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 96 114 80
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 30 (8.65%)
Serine (Ser, S)
n = 36 (10.37%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 29 (8.36%)
Methionine (Met, M)
n = 26 (7.49%)
Proline (Pro, P)
n = 17 (4.9%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 5 (1.44%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 15 20 14 16 16 7 9 11 1 2 1 2 2 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 5 15 9 1 0 5 8 2 3 6 6 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 27 2 5 9 15 2 0 5 1 4 1 0 3 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 2 1 1 11 0 0 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 94 127 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 125 53 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 106 151 63
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 30 (8.65%)
Serine (Ser, S)
n = 36 (10.37%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 29 (8.36%)
Methionine (Met, M)
n = 26 (7.49%)
Proline (Pro, P)
n = 17 (4.9%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 5 (1.44%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 15 20 14 16 16 7 9 11 1 2 1 2 2 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 5 15 9 1 0 5 8 2 3 6 6 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 27 2 5 9 15 2 0 5 1 4 1 0 3 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 2 1 1 11 0 0 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 94 127 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 125 53 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 106 151 63
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.37%)
Alanine (Ala, A)
n = 39 (8.52%)
Serine (Ser, S)
n = 41 (8.95%)
Threonine (Thr, T)
n = 39 (8.52%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 88 (19.21%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 28 (6.11%)
Proline (Pro, P)
n = 26 (5.68%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 11 (2.4%)
Tryptophan (Trp, W)
n = 17 (3.71%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 7 (1.53%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 17 21 18 16 21 9 21 12 1 3 5 6 1 6 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 3 5 19 14 1 2 7 5 6 2 5 17 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 17 1 7 11 13 1 2 7 4 7 3 3 9 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 3 2 2 7 0 1 4 6 0 0 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 127 141 103
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
61 136 74 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 142 181 98
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (7.14%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 1 3 7 5 5 5 1 2 0 1 1 0 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 0 6 1 1 1 3 2 1 0 1 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 6 2 3 2 4 0 0 2 0 0 0 1 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 0 2 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 33 21 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 29 14 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 35 29 20
ND5 (size: 1809 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.98%)
Alanine (Ala, A)
n = 46 (7.64%)
Serine (Ser, S)
n = 47 (7.81%)
Threonine (Thr, T)
n = 57 (9.47%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 25 (4.15%)
Leucine (Leu, L)
n = 96 (15.95%)
Isoleucine (Ile, I)
n = 59 (9.8%)
Methionine (Met, M)
n = 26 (4.32%)
Proline (Pro, P)
n = 30 (4.98%)
Phenylalanine (Phe, F)
n = 37 (6.15%)
Tyrosine (Tyr, Y)
n = 12 (1.99%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 15 (2.49%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 28 (4.65%)
Glutamine (Gln, Q)
n = 19 (3.16%)
Histidine (His, H)
n = 16 (2.66%)
Lysine (Lys, K)
n = 21 (3.49%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
38 21 16 22 17 35 8 9 16 3 5 9 10 1 24 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 5 2 9 18 17 2 2 13 10 5 2 10 15 3 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 26 2 9 7 15 2 3 11 3 9 2 5 14 14 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 4 5 10 21 0 1 4 3 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
126 156 205 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 166 122 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 187 210 158
ND6 (size: 510 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.79%)
Alanine (Ala, A)
n = 19 (11.24%)
Serine (Ser, S)
n = 12 (7.1%)
Threonine (Thr, T)
n = 4 (2.37%)
Cysteine (Cys, C)
n = 2 (1.18%)
Valine (Val, V)
n = 26 (15.38%)
Leucine (Leu, L)
n = 32 (18.93%)
Isoleucine (Ile, I)
n = 4 (2.37%)
Methionine (Met, M)
n = 6 (3.55%)
Proline (Pro, P)
n = 4 (2.37%)
Phenylalanine (Phe, F)
n = 8 (4.73%)
Tyrosine (Tyr, Y)
n = 11 (6.51%)
Tryptophan (Trp, W)
n = 3 (1.78%)
Aspartic acid (Asp, D)
n = 1 (0.59%)
Glutamic acid (Glu, E)
n = 4 (2.37%)
Asparagine (Asn, N)
n = 2 (1.18%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.18%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 3 3 0 1 3 13 0 0 13 3 2 8 8 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 11 0 5 3 5 3 1 16 1 0 1 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 7 2 1 0 2 0 8 3 2 12 1 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 1 0 0 0 2 1 1 0 1 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 17 19 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 37 20 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 15 30 72
Total protein-coding genes (size: 11364 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 232 (6.13%)
Alanine (Ala, A)
n = 311 (8.22%)
Serine (Ser, S)
n = 275 (7.27%)
Threonine (Thr, T)
n = 313 (8.27%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 195 (5.15%)
Leucine (Leu, L)
n = 620 (16.38%)
Isoleucine (Ile, I)
n = 318 (8.4%)
Methionine (Met, M)
n = 182 (4.81%)
Proline (Pro, P)
n = 209 (5.52%)
Phenylalanine (Phe, F)
n = 231 (6.1%)
Tyrosine (Tyr, Y)
n = 106 (2.8%)
Tryptophan (Trp, W)
n = 114 (3.01%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 96 (2.54%)
Asparagine (Asn, N)
n = 129 (3.41%)
Glutamine (Gln, Q)
n = 98 (2.59%)
Histidine (His, H)
n = 103 (2.72%)
Lysine (Lys, K)
n = 77 (2.03%)
Arginine (Arg, R)
n = 74 (1.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
192 126 119 131 112 159 67 115 81 17 58 47 66 24 126 105
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
63 11 16 60 134 104 13 23 82 80 47 26 57 103 23 57
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
90 155 11 54 52 100 13 10 46 43 63 13 36 54 75 29
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
74 55 41 21 48 74 3 11 23 33 7 1 0 5 1 101
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
903 953 1076 854
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
504 1052 684 1546
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
379 1150 1351 906

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.