Viewing data for Ammodytes hexapterus


Scientific name Ammodytes hexapterus
Common name Pacific sand lance
Maximum lifespan 8.00 years (Ammodytes hexapterus@AnAge)

Total mtDNA (size: 16527 bases) GC AT G C A T
Base content (bases) 7837 8690 4877 2960 4384 4306
Base content per 1 kb (bases) 474 526 295 179 265 261
Base content (%) 47.4% 52.6%
Total protein-coding genes (size: 11415 bases) GC AT G C A T
Base content (bases) 5515 5900 3584 1931 3189 2711
Base content per 1 kb (bases) 483 517 314 169 279 237
Base content (%) 48.3% 51.7%
D-loop (size: 862 bases) GC AT G C A T
Base content (bases) 343 519 202 141 254 265
Base content per 1 kb (bases) 398 602 234 164 295 307
Base content (%) 39.8% 60.2%
Total tRNA-coding genes (size: 1554 bases) GC AT G C A T
Base content (bases) 699 855 383 316 386 469
Base content per 1 kb (bases) 450 550 246 203 248 302
Base content (%) 45.0% 55.0%
Total rRNA-coding genes (size: 2641 bases) GC AT G C A T
Base content (bases) 1251 1390 686 565 542 848
Base content per 1 kb (bases) 474 526 260 214 205 321
Base content (%) 47.4% 52.6%
12S rRNA gene (size: 945 bases) GC AT G C A T
Base content (bases) 464 481 251 213 188 293
Base content per 1 kb (bases) 491 509 266 225 199 310
Base content (%) 49.1% 50.9%
16S rRNA gene (size: 1696 bases) GC AT G C A T
Base content (bases) 787 909 435 352 354 555
Base content per 1 kb (bases) 464 536 256 208 209 327
Base content (%) 46.4% 53.6%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 327 357 233 94 206 151
Base content per 1 kb (bases) 478 522 341 137 301 221
Base content (%) 47.8% 52.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 71 97 54 17 42 55
Base content per 1 kb (bases) 423 577 321 101 250 327
Base content (%) 42.3% 57.7%
COX1 (size: 1560 bases) GC AT G C A T
Base content (bases) 734 826 439 295 462 364
Base content per 1 kb (bases) 471 529 281 189 296 233
Base content (%) 47.1% 52.9%
COX2 (size: 690 bases) GC AT G C A T
Base content (bases) 315 375 201 114 181 194
Base content per 1 kb (bases) 457 543 291 165 262 281
Base content (%) 45.7% 54.3%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 397 388 253 144 211 177
Base content per 1 kb (bases) 506 494 322 183 269 225
Base content (%) 50.6% 49.4%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 555 586 356 199 342 244
Base content per 1 kb (bases) 486 514 312 174 300 214
Base content (%) 48.6% 51.4%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 470 505 293 177 290 215
Base content per 1 kb (bases) 482 518 301 182 297 221
Base content (%) 48.2% 51.8%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 538 508 358 180 278 230
Base content per 1 kb (bases) 514 486 342 172 266 220
Base content (%) 51.4% 48.6%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 181 168 120 61 103 65
Base content per 1 kb (bases) 519 481 344 175 295 186
Base content (%) 51.9% 48.1%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 660 721 433 227 395 326
Base content per 1 kb (bases) 478 522 314 164 286 236
Base content (%) 47.8% 52.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 148 149 101 47 88 61
Base content per 1 kb (bases) 498 502 340 158 296 205
Base content (%) 49.8% 50.2%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 858 981 572 286 511 470
Base content per 1 kb (bases) 467 533 311 156 278 256
Base content (%) 46.7% 53.3%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 267 255 174 93 86 169
Base content per 1 kb (bases) 511 489 333 178 165 324
Base content (%) 51.1% 48.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 9 (3.96%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 58 (25.55%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 6 2 22 14 9 4 9 6 3 4 5 4 0 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 3 12 2 1 1 6 3 1 6 9 2 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 7 1 0 1 1 2 0 5 0 4 0 0 3 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 1 0 0 3 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 84 62 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 60 31 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 89 58 61
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWFAILAFSWLVFLTVIPPKVMAHTFPNTPTSKSTEKPKATTWNWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 4 (7.27%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 1 0 0 2 0 2 0 1 2 0 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 3 0 0 0 0 0 3 3 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 2 1 0 0 0 1 0 0 0 0 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 0 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
8 14 19 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 23 12 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 17 24 12
COX1 (size: 1560 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.25%)
Alanine (Ala, A)
n = 46 (8.86%)
Serine (Ser, S)
n = 29 (5.59%)
Threonine (Thr, T)
n = 36 (6.94%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 40 (7.71%)
Leucine (Leu, L)
n = 66 (12.72%)
Isoleucine (Ile, I)
n = 42 (8.09%)
Methionine (Met, M)
n = 23 (4.43%)
Proline (Pro, P)
n = 28 (5.39%)
Phenylalanine (Phe, F)
n = 40 (7.71%)
Tyrosine (Tyr, Y)
n = 19 (3.66%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 14 (2.7%)
Glutamic acid (Glu, E)
n = 12 (2.31%)
Asparagine (Asn, N)
n = 14 (2.7%)
Glutamine (Gln, Q)
n = 8 (1.54%)
Histidine (His, H)
n = 18 (3.47%)
Lysine (Lys, K)
n = 8 (1.54%)
Arginine (Arg, R)
n = 9 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 17 7 22 14 11 10 8 6 2 9 6 19 6 12 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
16 0 2 11 20 13 2 12 19 9 8 11 10 6 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 17 1 6 10 8 0 0 5 7 12 1 1 7 7 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 11 1 2 12 7 1 2 1 4 2 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
160 120 129 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
82 134 93 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 185 142 140
COX2 (size: 690 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 15 (6.55%)
Threonine (Thr, T)
n = 9 (3.93%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 6 (2.62%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 7 9 8 5 4 2 7 1 2 8 9 2 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 3 6 7 1 3 1 4 1 3 7 3 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 1 6 5 0 1 2 3 6 0 0 4 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 14 0 2 11 4 0 0 3 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 64 52 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 52 65 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 85 77 53
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 9 4 13 4 4 6 5 5 3 6 8 4 0 6 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 11 4 2 3 10 8 1 0 9 1 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 1 7 2 2 0 0 3 0 12 0 0 1 1 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 2 0 5 0 2 1 0 1 3 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 68 52 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 68 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 117 69 50
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (7.65%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 22 (5.8%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 32 (8.44%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 25 (6.6%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 32 (8.44%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 12 2 21 16 14 4 4 4 2 8 14 8 2 7 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 5 9 13 1 7 6 9 7 10 9 1 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 1 2 5 9 6 3 1 1 1 13 3 1 4 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 2 3 2 10 6 3 0 1 6 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 101 84 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 94 75 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 161 85 95
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 38 (11.73%)
Serine (Ser, S)
n = 18 (5.56%)
Threonine (Thr, T)
n = 18 (5.56%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 21 (6.48%)
Leucine (Leu, L)
n = 65 (20.06%)
Isoleucine (Ile, I)
n = 21 (6.48%)
Methionine (Met, M)
n = 9 (2.78%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 7 4 15 9 19 9 7 6 1 4 11 6 0 9 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 19 6 7 4 7 4 3 8 10 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 4 6 3 4 3 0 2 6 6 4 6 5 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 5 2 2 6 1 5 0 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
92 95 69 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 96 58 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 102 88 87
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (5.76%)
Alanine (Ala, A)
n = 42 (12.1%)
Serine (Ser, S)
n = 21 (6.05%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 79 (22.77%)
Isoleucine (Ile, I)
n = 17 (4.9%)
Methionine (Met, M)
n = 12 (3.46%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 4 5 20 16 15 18 9 7 8 5 3 2 2 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 10 21 7 4 2 9 6 3 5 12 3 2 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 7 3 3 7 7 1 1 2 2 5 6 1 5 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 3 0 1 6 3 3 0 0 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 117 94 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 125 54 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
62 116 81 89
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (5.76%)
Alanine (Ala, A)
n = 42 (12.1%)
Serine (Ser, S)
n = 21 (6.05%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 79 (22.77%)
Isoleucine (Ile, I)
n = 17 (4.9%)
Methionine (Met, M)
n = 12 (3.46%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 4 5 20 16 15 18 9 7 8 5 3 2 2 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 10 21 7 4 2 9 6 3 5 12 3 2 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 7 3 3 7 7 1 1 2 2 5 6 1 5 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 3 0 1 6 3 3 0 0 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 117 94 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 125 54 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
62 116 81 89
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.58%)
Alanine (Ala, A)
n = 46 (10.02%)
Serine (Ser, S)
n = 33 (7.19%)
Threonine (Thr, T)
n = 38 (8.28%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 17 (3.7%)
Leucine (Leu, L)
n = 94 (20.48%)
Isoleucine (Ile, I)
n = 36 (7.84%)
Methionine (Met, M)
n = 24 (5.23%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 17 (3.7%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 9 (1.96%)
Histidine (His, H)
n = 13 (2.83%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 14 11 25 30 13 9 14 8 1 2 4 8 3 10 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 3 2 11 24 9 2 1 7 5 8 8 11 4 3 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 10 5 12 7 2 0 3 9 5 9 4 3 3 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 7 0 5 9 2 1 3 6 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 136 134 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 131 76 187
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
61 166 116 117
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 2 4 6 6 4 3 3 0 1 1 0 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 3 6 3 0 0 4 2 0 0 2 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 1 4 3 1 2 0 0 0 0 1 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 2 0 0 0 2 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 32 18 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 31 14 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 38 29 24
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.07%)
Alanine (Ala, A)
n = 55 (8.99%)
Serine (Ser, S)
n = 45 (7.35%)
Threonine (Thr, T)
n = 58 (9.48%)
Cysteine (Cys, C)
n = 7 (1.14%)
Valine (Val, V)
n = 29 (4.74%)
Leucine (Leu, L)
n = 94 (15.36%)
Isoleucine (Ile, I)
n = 48 (7.84%)
Methionine (Met, M)
n = 30 (4.9%)
Proline (Pro, P)
n = 31 (5.07%)
Phenylalanine (Phe, F)
n = 40 (6.54%)
Tyrosine (Tyr, Y)
n = 11 (1.8%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 13 (2.12%)
Asparagine (Asn, N)
n = 29 (4.74%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 14 (2.29%)
Lysine (Lys, K)
n = 19 (3.1%)
Arginine (Arg, R)
n = 10 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 25 15 29 25 22 5 10 15 7 12 9 6 2 19 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
15 1 6 13 23 17 2 5 18 7 1 12 11 7 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 14 8 11 10 8 2 3 11 3 8 8 3 7 22 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 5 2 10 12 7 0 3 4 3 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
140 158 198 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 175 121 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
70 239 151 153
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (15.03%)
Alanine (Ala, A)
n = 18 (10.4%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 24 (13.87%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 8 (4.62%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 1 5 1 6 3 13 0 1 5 5 4 10 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 5 2 5 6 5 2 5 14 1 2 1 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 4 1 1 4 2 1 3 6 1 3 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 4 2 0 0 0 1 0 2 2 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 28 21 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 39 20 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 26 45 44
Total protein-coding genes (size: 11437 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 247 (6.48%)
Alanine (Ala, A)
n = 352 (9.24%)
Serine (Ser, S)
n = 244 (6.41%)
Threonine (Thr, T)
n = 297 (7.8%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 238 (6.25%)
Leucine (Leu, L)
n = 660 (17.33%)
Isoleucine (Ile, I)
n = 257 (6.75%)
Methionine (Met, M)
n = 151 (3.96%)
Proline (Pro, P)
n = 221 (5.8%)
Phenylalanine (Phe, F)
n = 229 (6.01%)
Tyrosine (Tyr, Y)
n = 113 (2.97%)
Tryptophan (Trp, W)
n = 117 (3.07%)
Aspartic acid (Asp, D)
n = 75 (1.97%)
Glutamic acid (Glu, E)
n = 99 (2.6%)
Asparagine (Asn, N)
n = 119 (3.12%)
Glutamine (Gln, Q)
n = 100 (2.63%)
Histidine (His, H)
n = 104 (2.73%)
Lysine (Lys, K)
n = 75 (1.97%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
148 109 63 192 151 130 81 87 69 31 62 77 71 28 92 137
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
88 9 18 74 160 90 28 43 93 64 47 69 102 37 13 66
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
121 82 28 59 64 50 16 13 42 31 82 29 19 43 76 23
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
81 66 33 13 62 54 21 13 16 33 15 0 1 5 2 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1011 1056 955 788
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
524 1059 692 1535
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
480 1391 989 950

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.