Viewing data for Cephalophus dorsalis


Scientific name Cephalophus dorsalis
Common name Bay duiker
Maximum lifespan 17.50 years (Cephalophus dorsalis@AnAge)

Total mtDNA (size: 16434 bases) GC AT G C A T
Base content (bases) 6564 9861 4362 2202 4381 5480
Base content per 1 kb (bases) 399 600 265 134 267 333
Base content (%) 39.9% 60.0%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4564 6765 3210 1354 3076 3689
Base content per 1 kb (bases) 403 597 283 119 271 325
Base content (%) 40.3% 59.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 552 959 324 228 423 536
Base content per 1 kb (bases) 365 635 214 151 280 355
Base content (%) 36.5% 63.5%
Total rRNA-coding genes (size: 2528 bases) GC AT G C A T
Base content (bases) 1017 1511 567 450 577 934
Base content per 1 kb (bases) 402 598 224 178 228 369
Base content (%) 40.2% 59.8%
12S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 399 554 226 173 208 346
Base content per 1 kb (bases) 419 581 237 182 218 363
Base content (%) 41.9% 58.1%
16S rRNA gene (size: 1575 bases) GC AT G C A T
Base content (bases) 618 957 341 277 369 588
Base content per 1 kb (bases) 392 608 217 176 234 373
Base content (%) 39.2% 60.8%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 269 412 194 75 191 221
Base content per 1 kb (bases) 395 605 285 110 280 325
Base content (%) 39.5% 60.5%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 64 137 52 12 54 83
Base content per 1 kb (bases) 318 682 259 60 269 413
Base content (%) 31.8% 68.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 638 907 386 252 464 443
Base content per 1 kb (bases) 413 587 250 163 300 287
Base content (%) 41.3% 58.7%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 262 422 173 89 171 251
Base content per 1 kb (bases) 383 617 253 130 250 367
Base content (%) 38.3% 61.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 336 448 224 112 232 216
Base content per 1 kb (bases) 429 571 286 143 296 276
Base content (%) 42.9% 57.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 489 651 342 147 295 356
Base content per 1 kb (bases) 429 571 300 129 259 312
Base content (%) 42.9% 57.1%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 394 562 276 118 266 296
Base content per 1 kb (bases) 412 588 289 123 278 310
Base content (%) 41.2% 58.8%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 392 650 300 92 272 378
Base content per 1 kb (bases) 376 624 288 88 261 363
Base content (%) 37.6% 62.4%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 151 195 111 40 88 107
Base content per 1 kb (bases) 436 564 321 116 254 309
Base content (%) 43.6% 56.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 547 822 393 154 381 441
Base content per 1 kb (bases) 397 597 285 112 276 320
Base content (%) 39.7% 59.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 112 185 75 37 92 93
Base content per 1 kb (bases) 377 623 253 125 310 313
Base content (%) 37.7% 62.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 730 1091 542 188 483 608
Base content per 1 kb (bases) 401 599 298 103 265 334
Base content (%) 40.1% 59.9%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 200 328 156 44 109 219
Base content per 1 kb (bases) 379 621 295 83 206 415
Base content (%) 37.9% 62.1%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 46 (20.35%)
Isoleucine (Ile, I)
n = 23 (10.18%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 7 10 5 8 20 3 9 9 0 1 5 5 0 9 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 9 6 0 2 2 7 0 2 3 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 1 2 2 6 0 1 5 1 1 0 1 5 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 4 0 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 67 79 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 62 37 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 65 105 49
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLVLFIIFQLKISKHNFYLNPELMSMKTSKQNTPWETKWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (9.09%)
Threonine (Thr, T)
n = 7 (10.61%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 12 (18.18%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 5 (7.58%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 4 2 1 6 0 2 3 0 0 1 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 2 0 0 6 0 0 0 1 1 0 1 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 5 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 26 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 18 19 27
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 16 38 8
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 13 29 6 8 28 2 14 4 2 6 6 21 4 17 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 13 11 15 1 12 7 21 7 10 9 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 15 2 10 4 12 1 1 2 6 13 0 2 6 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 0 4 11 8 1 1 1 4 2 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 103 141 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 95 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 150 207 130
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 10 14 1 4 19 2 7 6 0 1 2 8 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 1 1 5 1 2 2 3 1 0 4 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 12 2 5 3 8 0 2 3 4 6 0 1 2 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 1 1 9 5 1 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 59 69 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 59 121 37
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 6 9 6 7 11 1 5 7 0 3 6 6 1 11 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 5 7 4 0 3 9 8 0 4 2 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 4 1 10 0 1 3 5 6 0 2 3 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 1 2 2 0 0 3 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 66 61 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 92 99 64
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 40 (10.55%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 21 13 6 16 26 2 7 6 0 4 5 8 0 9 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 3 7 16 0 2 7 13 2 2 5 14 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 17 0 1 7 10 1 0 3 5 11 1 0 1 17 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 1 10 8 1 0 1 7 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 98 115 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 95 78 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 149 163 57
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 24 (7.57%)
Threonine (Thr, T)
n = 22 (6.94%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 55 (17.35%)
Isoleucine (Ile, I)
n = 30 (9.46%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 11 (3.47%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 16 12 7 7 30 3 8 7 0 4 3 7 0 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 3 9 15 1 2 5 4 1 3 8 11 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 2 2 7 9 1 0 5 5 7 0 0 4 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 1 2 6 1 0 1 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 87 93 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 91 54 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 98 148 57
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 20 35 4 10 31 3 7 9 1 3 6 4 0 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 7 8 0 1 4 9 0 1 9 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 20 0 2 10 13 0 1 1 2 6 1 1 2 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 2 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 86 145 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 99 59 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 115 174 46
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 20 35 4 10 31 3 7 9 1 3 6 4 0 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 7 8 0 1 4 9 0 1 9 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 20 0 2 10 13 0 1 1 2 6 1 1 2 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 2 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 86 145 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 99 59 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 115 174 46
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 18 (3.93%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 24 (5.24%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 19 29 13 14 48 3 13 9 2 1 7 9 1 6 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 5 8 13 1 2 7 6 3 0 11 8 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 21 3 5 14 7 1 4 6 2 11 1 2 9 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 0 1 3 11 0 2 1 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 130 155 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 110 82 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 149 201 77
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 11 1 2 10 2 7 2 0 0 2 6 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 2 5 0 0 2 2 0 0 0 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 1 6 1 1 0 1 3 0 0 0 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 21 27 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 16 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 31 50 13
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 38 (6.27%)
Serine (Ser, S)
n = 48 (7.92%)
Threonine (Thr, T)
n = 59 (9.74%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 61 (10.07%)
Methionine (Met, M)
n = 42 (6.93%)
Proline (Pro, P)
n = 27 (4.46%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 20 (3.3%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 36 (5.94%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 32 39 9 20 44 4 11 18 0 1 5 7 0 14 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 4 13 20 1 3 9 13 4 5 12 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 28 3 6 18 12 0 1 11 6 14 1 1 8 28 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 1 3 7 20 2 0 5 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
101 142 232 132
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 160 129 252
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 240 247 99
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 1 1 0 0 1 0 9 0 1 9 1 3 9 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 0 3 2 2 0 10 3 3 10 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 2 3 2 1 1 4 0 8 2 3 8 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 4 0 2 2 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 6 48 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 12 28 84
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.69%)
Alanine (Ala, A)
n = 244 (6.42%)
Serine (Ser, S)
n = 278 (7.32%)
Threonine (Thr, T)
n = 316 (8.32%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 184 (4.84%)
Leucine (Leu, L)
n = 602 (15.85%)
Isoleucine (Ile, I)
n = 335 (8.82%)
Methionine (Met, M)
n = 254 (6.69%)
Proline (Pro, P)
n = 191 (5.03%)
Phenylalanine (Phe, F)
n = 244 (6.42%)
Tyrosine (Tyr, Y)
n = 131 (3.45%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 164 (4.32%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 94 (2.47%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 64 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
177 157 211 60 106 290 26 100 83 6 34 49 86 15 107 135
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 6 16 44 83 112 5 39 57 92 28 33 68 84 5 37
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
100 162 17 41 75 98 6 15 42 50 79 7 19 47 117 24
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
70 84 11 18 49 86 10 4 16 42 2 1 0 7 0 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
806 919 1222 843
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
464 970 741 1615
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
200 1219 1635 736

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.