Viewing data for Pyrrhula pyrrhula


Scientific name Pyrrhula pyrrhula
Common name Eurasian bullfinch
Maximum lifespan 17.50 years (Pyrrhula pyrrhula@AnAge)

Total mtDNA (size: 16831 bases) GC AT G C A T
Base content (bases) 7721 9109 5311 2410 3982 5127
Base content per 1 kb (bases) 459 541 316 143 237 305
Base content (%) 45.9% 54.1%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5350 6027 3881 1469 2669 3358
Base content per 1 kb (bases) 470 530 341 129 235 295
Base content (%) 47.0% 53.0%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1541 bases) GC AT G C A T
Base content (bases) 635 906 376 259 390 516
Base content per 1 kb (bases) 412 588 244 168 253 335
Base content (%) 41.2% 58.8%
Total rRNA-coding genes (size: 2572 bases) GC AT G C A T
Base content (bases) 1173 1399 651 522 550 849
Base content per 1 kb (bases) 456 544 253 203 214 330
Base content (%) 45.6% 54.4%
12S rRNA gene (size: 974 bases) GC AT G C A T
Base content (bases) 471 503 262 209 207 296
Base content per 1 kb (bases) 484 516 269 215 213 304
Base content (%) 48.4% 51.6%
16S rRNA gene (size: 1598 bases) GC AT G C A T
Base content (bases) 702 896 389 313 343 553
Base content per 1 kb (bases) 439 561 243 196 215 346
Base content (%) 43.9% 56.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 305 379 236 69 173 206
Base content per 1 kb (bases) 446 554 345 101 253 301
Base content (%) 44.6% 55.4%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 78 90 66 12 42 48
Base content per 1 kb (bases) 464 536 393 71 250 286
Base content (%) 46.4% 53.6%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 728 823 474 254 379 444
Base content per 1 kb (bases) 469 531 306 164 244 286
Base content (%) 46.9% 53.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 323 361 218 105 154 207
Base content per 1 kb (bases) 472 528 319 154 225 303
Base content (%) 47.2% 52.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 380 404 259 121 185 219
Base content per 1 kb (bases) 485 515 330 154 236 279
Base content (%) 48.5% 51.5%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 539 604 387 152 274 330
Base content per 1 kb (bases) 472 528 339 133 240 289
Base content (%) 47.2% 52.8%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 467 511 326 141 246 265
Base content per 1 kb (bases) 478 522 333 144 252 271
Base content (%) 47.8% 52.2%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 474 565 363 111 258 307
Base content per 1 kb (bases) 456 543 349 107 248 295
Base content (%) 45.6% 54.3%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 167 184 122 45 90 94
Base content per 1 kb (bases) 476 524 348 128 256 268
Base content (%) 47.6% 52.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 640 738 487 153 322 416
Base content per 1 kb (bases) 464 536 353 111 234 302
Base content (%) 46.4% 53.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 153 144 115 38 67 77
Base content per 1 kb (bases) 515 485 387 128 226 259
Base content (%) 51.5% 48.5%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 832 986 617 215 430 556
Base content per 1 kb (bases) 458 542 339 118 237 306
Base content (%) 45.8% 54.2%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 269 250 214 55 53 197
Base content per 1 kb (bases) 518 482 412 106 102 380
Base content (%) 51.8% 48.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 6 6 12 36 3 5 8 0 1 2 3 2 2 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 5 7 5 0 1 3 3 0 2 5 7 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 11 1 1 6 5 0 0 4 0 3 0 0 1 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 2 4 0 0 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 88 66 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 66 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 82 105 31
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMIISWLTFSLIIQPKLLSFVSMNPPSSKPPATPTTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 1 1 2 2 0 0 2 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 1 0 0 0 0 0 3 4 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 0 0 0 2 3 0 0 1 0 0 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 1 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 18 20 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 25 7 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 23 21 9
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 29 (5.62%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.75%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 39 (7.56%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 30 20 5 14 36 0 7 9 0 3 16 18 3 5 38
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 11 17 17 1 4 9 26 8 5 9 16 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 21 0 3 8 14 0 0 4 2 15 2 1 3 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 10 0 3 12 9 0 1 2 5 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
158 121 127 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 94 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 215 223 61
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 19 (8.37%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 13 (5.73%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 10 (4.41%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 8 10 2 8 14 4 2 6 1 3 3 11 2 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 3 7 6 0 3 1 4 0 3 3 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 1 4 8 4 0 0 5 0 7 1 0 2 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 0 1 12 4 0 0 2 3 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 62 57 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 60 58 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 96 92 28
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 10 6 1 6 23 0 2 6 2 1 4 9 2 4 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 3 12 8 1 1 6 11 1 2 6 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 8 0 3 6 4 0 1 3 2 8 0 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 1 0 4 4 0 0 2 2 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 73 56 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 71 56 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 115 107 30
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 29 (7.63%)
Serine (Ser, S)
n = 21 (5.53%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 22 (5.79%)
Leucine (Leu, L)
n = 64 (16.84%)
Isoleucine (Ile, I)
n = 34 (8.95%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 26 7 4 15 37 5 3 7 1 1 8 12 1 3 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 2 18 8 1 2 11 9 2 4 7 13 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 15 0 2 7 10 1 0 1 2 10 1 0 4 17 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 2 7 9 1 2 2 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 113 100 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 99 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 175 151 41
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 27 (8.31%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 67 (20.62%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 16 (4.92%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 14 (4.31%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 16 7 9 12 32 7 6 5 1 0 5 11 1 3 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 4 12 12 2 3 5 4 1 2 9 12 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 6 0 4 9 7 1 0 6 4 11 1 1 1 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 1 3 5 2 2 2 3 1 1 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 100 81 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 94 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 132 125 42
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 29 (8.41%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 68 (19.71%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 13 (3.77%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 29 11 10 15 29 6 8 8 2 0 4 4 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 7 9 11 2 0 6 6 1 6 9 7 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 9 3 7 10 9 1 0 5 1 6 2 0 0 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 1 0 12 2 0 2 1 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 105 119 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 118 58 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 140 128 55
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 29 (8.41%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 68 (19.71%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 13 (3.77%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 29 11 10 15 29 6 8 8 2 0 4 4 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 7 9 11 2 0 6 6 1 6 9 7 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 9 3 7 10 9 1 0 5 1 6 2 0 0 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 1 0 12 2 0 2 1 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 105 119 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 118 58 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 140 128 55
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 41 (8.95%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 100 (21.83%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 12 (2.62%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 15 (3.28%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 33 22 8 27 51 7 7 14 0 3 4 3 1 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 4 24 13 0 2 8 7 1 3 11 11 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 18 1 7 12 8 1 0 10 4 9 1 0 1 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 0 0 2 10 0 0 1 10 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 159 143 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 136 78 191
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 192 195 55
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 5 2 3 14 0 0 2 0 0 0 2 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 1 7 2 0 0 4 0 0 0 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 0 8 1 0 0 4 0 3 1 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 0 0 1 0 0 0 0 2 1 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 33 25 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 29 17 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 53 35 7
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 47 (7.77%)
Serine (Ser, S)
n = 51 (8.43%)
Threonine (Thr, T)
n = 67 (11.07%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 19 (3.14%)
Leucine (Leu, L)
n = 104 (17.19%)
Isoleucine (Ile, I)
n = 51 (8.43%)
Methionine (Met, M)
n = 30 (4.96%)
Proline (Pro, P)
n = 29 (4.79%)
Phenylalanine (Phe, F)
n = 38 (6.28%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 28 (4.63%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 42 25 9 21 59 9 6 15 2 2 7 9 1 7 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 3 4 30 12 1 3 9 17 4 5 13 11 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
30 21 1 9 19 11 1 1 10 0 13 1 0 4 24 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 12 0 1 7 21 0 1 1 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
119 163 209 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 183 110 242
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 271 237 73
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.86%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 17 (9.88%)
Threonine (Thr, T)
n = 3 (1.74%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 35 (20.35%)
Leucine (Leu, L)
n = 31 (18.02%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 4 (2.33%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 9 (5.23%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 1 4 0 0 3 8 0 0 13 1 2 19 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 0 2 6 2 1 5 21 3 0 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 1 1 5 5 0 6 1 4 16 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 2 1 0 0 0 0 0 4 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 15 16 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 31 17 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
87 9 20 57
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 220 (5.8%)
Alanine (Ala, A)
n = 312 (8.22%)
Serine (Ser, S)
n = 296 (7.8%)
Threonine (Thr, T)
n = 313 (8.25%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 199 (5.24%)
Leucine (Leu, L)
n = 675 (17.78%)
Isoleucine (Ile, I)
n = 291 (7.67%)
Methionine (Met, M)
n = 155 (4.08%)
Proline (Pro, P)
n = 222 (5.85%)
Phenylalanine (Phe, F)
n = 216 (5.69%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 67 (1.77%)
Glutamic acid (Glu, E)
n = 88 (2.32%)
Asparagine (Asn, N)
n = 135 (3.56%)
Glutamine (Gln, Q)
n = 94 (2.48%)
Histidine (His, H)
n = 102 (2.69%)
Lysine (Lys, K)
n = 86 (2.27%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
75 216 125 63 141 351 47 54 85 9 27 54 86 32 44 172
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
30 9 19 49 150 99 14 21 64 95 40 39 81 97 5 55
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
131 119 8 46 102 77 10 7 54 21 88 15 19 18 117 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
92 80 8 13 54 80 6 6 16 41 9 2 1 6 1 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
886 1092 1044 774
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
490 1082 688 1536
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
254 1551 1488 503

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.