Viewing data for Bungarus multicinctus


Scientific name Bungarus multicinctus
Common name Many-banded krait
Maximum lifespan 13.70 years (Bungarus multicinctus@AnAge)

Total mtDNA (size: 17144 bases) GC AT G C A T
Base content (bases) 6611 10533 4488 2123 4888 5645
Base content per 1 kb (bases) 386 614 262 124 285 329
Base content (%) 38.6% 61.4%
Total protein-coding genes (size: 11232 bases) GC AT G C A T
Base content (bases) 4250 6982 2992 1258 3229 3753
Base content per 1 kb (bases) 378 622 266 112 287 334
Base content (%) 37.8% 62.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1427 bases) GC AT G C A T
Base content (bases) 579 848 333 246 382 466
Base content per 1 kb (bases) 406 594 233 172 268 327
Base content (%) 40.6% 59.4%
Total rRNA-coding genes (size: 2394 bases) GC AT G C A T
Base content (bases) 985 1409 584 401 530 879
Base content per 1 kb (bases) 411 589 244 168 221 367
Base content (%) 41.1% 58.9%
12S rRNA gene (size: 932 bases) GC AT G C A T
Base content (bases) 397 535 235 162 193 342
Base content per 1 kb (bases) 426 574 252 174 207 367
Base content (%) 42.6% 57.4%
16S rRNA gene (size: 1462 bases) GC AT G C A T
Base content (bases) 588 874 349 239 337 537
Base content per 1 kb (bases) 402 598 239 163 231 367
Base content (%) 40.2% 59.8%

ATP6 (size: 680 bases) GC AT G C A T
Base content (bases) 236 444 177 59 205 239
Base content per 1 kb (bases) 347 653 260 87 301 351
Base content (%) 34.7% 65.3%
ATP8 (size: 159 bases) GC AT G C A T
Base content (bases) 44 115 36 8 51 64
Base content per 1 kb (bases) 277 723 226 50 321 403
Base content (%) 27.7% 72.3%
COX1 (size: 1608 bases) GC AT G C A T
Base content (bases) 677 931 423 254 483 448
Base content per 1 kb (bases) 421 579 263 158 300 279
Base content (%) 42.1% 57.9%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 278 407 168 110 182 225
Base content per 1 kb (bases) 406 594 245 161 266 328
Base content (%) 40.6% 59.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 323 461 211 112 223 238
Base content per 1 kb (bases) 412 588 269 143 284 304
Base content (%) 41.2% 58.8%
CYTB (size: 1111 bases) GC AT G C A T
Base content (bases) 410 701 300 110 352 349
Base content per 1 kb (bases) 369 631 270 99 317 314
Base content (%) 36.9% 63.1%
ND1 (size: 964 bases) GC AT G C A T
Base content (bases) 368 596 260 108 278 318
Base content per 1 kb (bases) 382 618 270 112 288 330
Base content (%) 38.2% 61.8%
ND2 (size: 1030 bases) GC AT G C A T
Base content (bases) 381 649 280 101 266 383
Base content per 1 kb (bases) 370 630 272 98 258 372
Base content (%) 37.0% 63.0%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 114 229 76 38 107 122
Base content per 1 kb (bases) 332 668 222 111 312 356
Base content (%) 33.2% 66.8%
ND4 (size: 1337 bases) GC AT G C A T
Base content (bases) 509 828 387 122 390 438
Base content per 1 kb (bases) 381 619 289 91 292 328
Base content (%) 38.1% 61.9%
ND4L (size: 290 bases) GC AT G C A T
Base content (bases) 109 181 74 35 91 90
Base content per 1 kb (bases) 376 624 255 121 314 310
Base content (%) 37.6% 62.4%
ND5 (size: 1761 bases) GC AT G C A T
Base content (bases) 626 1135 463 163 514 621
Base content per 1 kb (bases) 355 645 263 93 292 353
Base content (%) 35.5% 64.5%
ND6 (size: 495 bases) GC AT G C A T
Base content (bases) 178 317 139 39 91 226
Base content per 1 kb (bases) 360 640 281 79 184 457
Base content (%) 36.0% 64.0%

ATP6 (size: 680 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (2.67%)
Alanine (Ala, A)
n = 12 (5.33%)
Serine (Ser, S)
n = 12 (5.33%)
Threonine (Thr, T)
n = 27 (12.0%)
Cysteine (Cys, C)
n = 2 (0.89%)
Valine (Val, V)
n = 7 (3.11%)
Leucine (Leu, L)
n = 45 (20.0%)
Isoleucine (Ile, I)
n = 24 (10.67%)
Methionine (Met, M)
n = 21 (9.33%)
Proline (Pro, P)
n = 12 (5.33%)
Phenylalanine (Phe, F)
n = 9 (4.0%)
Tyrosine (Tyr, Y)
n = 6 (2.67%)
Tryptophan (Trp, W)
n = 2 (0.89%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 6 (2.67%)
Asparagine (Asn, N)
n = 12 (5.33%)
Glutamine (Gln, Q)
n = 6 (2.67%)
Histidine (His, H)
n = 5 (2.22%)
Lysine (Lys, K)
n = 6 (2.67%)
Arginine (Arg, R)
n = 5 (2.22%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 9 18 12 3 20 1 9 6 0 3 0 4 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 3 4 5 0 1 3 2 0 2 2 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 1 1 1 4 2 0 4 3 3 0 0 6 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 1 0 1 6 0 0 2 3 0 0 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
32 64 94 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 59 42 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 54 102 62
ATP8 (size: 159 bases)
Amino acid sequence: MPQLSTIYIFLIFSWTWLMLCLIMQKINTILMNKDTKLYTKPINLSPILPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.77%)
Threonine (Thr, T)
n = 6 (11.54%)
Cysteine (Cys, C)
n = 1 (1.92%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 9 (17.31%)
Isoleucine (Ile, I)
n = 8 (15.38%)
Methionine (Met, M)
n = 4 (7.69%)
Proline (Pro, P)
n = 4 (7.69%)
Phenylalanine (Phe, F)
n = 2 (3.85%)
Tyrosine (Tyr, Y)
n = 2 (3.85%)
Tryptophan (Trp, W)
n = 3 (5.77%)
Aspartic acid (Asp, D)
n = 1 (1.92%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.77%)
Glutamine (Gln, Q)
n = 2 (3.85%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.69%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 3 3 2 0 5 0 2 2 0 0 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 0 0 0 0 0 0 0 0 3 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 0 0 2 0 0 1 1 1 1 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 1 4 0 0 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 13 26 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 12 13 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 11 25 15
COX1 (size: 1608 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.22%)
Alanine (Ala, A)
n = 40 (7.48%)
Serine (Ser, S)
n = 36 (6.73%)
Threonine (Thr, T)
n = 39 (7.29%)
Cysteine (Cys, C)
n = 2 (0.37%)
Valine (Val, V)
n = 33 (6.17%)
Leucine (Leu, L)
n = 61 (11.4%)
Isoleucine (Ile, I)
n = 45 (8.41%)
Methionine (Met, M)
n = 32 (5.98%)
Proline (Pro, P)
n = 32 (5.98%)
Phenylalanine (Phe, F)
n = 46 (8.6%)
Tyrosine (Tyr, Y)
n = 16 (2.99%)
Tryptophan (Trp, W)
n = 19 (3.55%)
Aspartic acid (Asp, D)
n = 13 (2.43%)
Glutamic acid (Glu, E)
n = 10 (1.87%)
Asparagine (Asn, N)
n = 17 (3.18%)
Glutamine (Gln, Q)
n = 9 (1.68%)
Histidine (His, H)
n = 19 (3.55%)
Lysine (Lys, K)
n = 13 (2.43%)
Arginine (Arg, R)
n = 9 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 22 29 12 7 27 3 12 8 1 10 10 10 3 18 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 5 19 15 1 11 8 17 8 6 9 13 4 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 14 0 10 6 12 2 2 4 7 9 2 0 9 8 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 2 8 5 10 3 1 2 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
140 118 153 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 141 97 217
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 164 198 141
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 14 (6.17%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 8 9 1 10 1 9 10 0 2 3 13 0 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 3 5 11 0 0 2 5 2 3 1 8 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 6 1 1 1 11 0 1 2 3 4 1 0 2 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 14 1 6 4 2 1 1 1 1 3 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 57 55 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 64 58 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 47 112 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 13 (5.0%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 29 (11.15%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 18 (6.92%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 7 (2.69%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 8 6 5 15 1 7 6 0 2 6 9 1 11 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 5 2 6 0 3 7 7 2 2 4 5 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 9 0 5 1 6 0 1 3 3 10 1 1 1 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 1 3 1 7 0 1 0 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 64 69 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 65 61 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 82 108 63
CYTB (size: 1111 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (4.88%)
Alanine (Ala, A)
n = 20 (5.42%)
Serine (Ser, S)
n = 30 (8.13%)
Threonine (Thr, T)
n = 36 (9.76%)
Cysteine (Cys, C)
n = 2 (0.54%)
Valine (Val, V)
n = 8 (2.17%)
Leucine (Leu, L)
n = 47 (12.74%)
Isoleucine (Ile, I)
n = 47 (12.74%)
Methionine (Met, M)
n = 19 (5.15%)
Proline (Pro, P)
n = 21 (5.69%)
Phenylalanine (Phe, F)
n = 28 (7.59%)
Tyrosine (Tyr, Y)
n = 14 (3.79%)
Tryptophan (Trp, W)
n = 12 (3.25%)
Aspartic acid (Asp, D)
n = 7 (1.9%)
Glutamic acid (Glu, E)
n = 6 (1.63%)
Asparagine (Asn, N)
n = 21 (5.69%)
Glutamine (Gln, Q)
n = 8 (2.17%)
Histidine (His, H)
n = 12 (3.25%)
Lysine (Lys, K)
n = 8 (2.17%)
Arginine (Arg, R)
n = 6 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 17 16 9 7 17 0 14 8 0 0 4 3 1 14 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 8 4 7 1 5 4 9 0 2 5 13 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 15 1 4 11 11 2 0 2 6 8 1 0 10 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 0 3 4 7 1 2 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 80 133 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 105 76 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 115 140 104
ND1 (size: 964 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.31%)
Alanine (Ala, A)
n = 21 (6.56%)
Serine (Ser, S)
n = 24 (7.5%)
Threonine (Thr, T)
n = 27 (8.44%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 9 (2.81%)
Leucine (Leu, L)
n = 64 (20.0%)
Isoleucine (Ile, I)
n = 20 (6.25%)
Methionine (Met, M)
n = 28 (8.75%)
Proline (Pro, P)
n = 23 (7.19%)
Phenylalanine (Phe, F)
n = 15 (4.69%)
Tyrosine (Tyr, Y)
n = 9 (2.81%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.44%)
Asparagine (Asn, N)
n = 14 (4.38%)
Glutamine (Gln, Q)
n = 9 (2.81%)
Histidine (His, H)
n = 2 (0.63%)
Lysine (Lys, K)
n = 8 (2.5%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 7 27 10 6 35 2 11 8 1 3 2 4 0 11 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 6 6 9 0 4 4 6 3 2 5 16 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 1 7 4 12 1 0 0 4 5 2 0 5 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 0 3 7 1 0 4 3 0 0 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 94 97 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 95 56 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 71 165 72
ND2 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.63%)
Alanine (Ala, A)
n = 28 (8.19%)
Serine (Ser, S)
n = 25 (7.31%)
Threonine (Thr, T)
n = 53 (15.5%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.22%)
Leucine (Leu, L)
n = 51 (14.91%)
Isoleucine (Ile, I)
n = 29 (8.48%)
Methionine (Met, M)
n = 41 (11.99%)
Proline (Pro, P)
n = 18 (5.26%)
Phenylalanine (Phe, F)
n = 7 (2.05%)
Tyrosine (Tyr, Y)
n = 6 (1.75%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 13 (3.8%)
Glutamine (Gln, Q)
n = 9 (2.63%)
Histidine (His, H)
n = 9 (2.63%)
Lysine (Lys, K)
n = 13 (3.8%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 14 39 11 4 24 5 4 7 2 4 1 5 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 7 6 14 1 1 2 6 0 3 3 11 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 26 1 8 5 7 0 1 4 1 5 1 3 4 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 1 0 13 0 0 0 3 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 84 154 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 119 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 77 173 75
ND3 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.63%)
Alanine (Ala, A)
n = 28 (8.19%)
Serine (Ser, S)
n = 25 (7.31%)
Threonine (Thr, T)
n = 53 (15.5%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.22%)
Leucine (Leu, L)
n = 51 (14.91%)
Isoleucine (Ile, I)
n = 29 (8.48%)
Methionine (Met, M)
n = 41 (11.99%)
Proline (Pro, P)
n = 18 (5.26%)
Phenylalanine (Phe, F)
n = 7 (2.05%)
Tyrosine (Tyr, Y)
n = 6 (1.75%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 13 (3.8%)
Glutamine (Gln, Q)
n = 9 (2.63%)
Histidine (His, H)
n = 9 (2.63%)
Lysine (Lys, K)
n = 13 (3.8%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 14 39 11 4 24 5 4 7 2 4 1 5 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 7 6 14 1 1 2 6 0 3 3 11 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 26 1 8 5 7 0 1 4 1 5 1 3 4 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 1 0 13 0 0 0 3 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 84 154 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 119 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 77 173 75
ND4 (size: 1337 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (3.15%)
Alanine (Ala, A)
n = 30 (6.76%)
Serine (Ser, S)
n = 36 (8.11%)
Threonine (Thr, T)
n = 50 (11.26%)
Cysteine (Cys, C)
n = 4 (0.9%)
Valine (Val, V)
n = 7 (1.58%)
Leucine (Leu, L)
n = 85 (19.14%)
Isoleucine (Ile, I)
n = 43 (9.68%)
Methionine (Met, M)
n = 35 (7.88%)
Proline (Pro, P)
n = 22 (4.95%)
Phenylalanine (Phe, F)
n = 22 (4.95%)
Tyrosine (Tyr, Y)
n = 13 (2.93%)
Tryptophan (Trp, W)
n = 10 (2.25%)
Aspartic acid (Asp, D)
n = 4 (0.9%)
Glutamic acid (Glu, E)
n = 9 (2.03%)
Asparagine (Asn, N)
n = 14 (3.15%)
Glutamine (Gln, Q)
n = 18 (4.05%)
Histidine (His, H)
n = 9 (2.03%)
Lysine (Lys, K)
n = 11 (2.48%)
Arginine (Arg, R)
n = 9 (2.03%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 21 30 19 10 38 3 14 17 1 1 3 2 1 15 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 3 8 11 11 0 3 2 7 2 5 6 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 21 0 5 11 13 0 3 4 3 10 0 1 6 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 9 0 2 2 11 0 0 3 5 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 128 160 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 131 78 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 128 199 104
ND4L (size: 290 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.21%)
Alanine (Ala, A)
n = 6 (6.32%)
Serine (Ser, S)
n = 8 (8.42%)
Threonine (Thr, T)
n = 12 (12.63%)
Cysteine (Cys, C)
n = 2 (2.11%)
Valine (Val, V)
n = 7 (7.37%)
Leucine (Leu, L)
n = 21 (22.11%)
Isoleucine (Ile, I)
n = 7 (7.37%)
Methionine (Met, M)
n = 8 (8.42%)
Proline (Pro, P)
n = 2 (2.11%)
Phenylalanine (Phe, F)
n = 4 (4.21%)
Tyrosine (Tyr, Y)
n = 1 (1.05%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.05%)
Glutamic acid (Glu, E)
n = 2 (2.11%)
Asparagine (Asn, N)
n = 4 (4.21%)
Glutamine (Gln, Q)
n = 2 (2.11%)
Histidine (His, H)
n = 2 (2.11%)
Lysine (Lys, K)
n = 2 (2.11%)
Arginine (Arg, R)
n = 1 (1.05%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 2 5 3 4 11 0 3 2 0 2 1 4 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 1 1 3 1 1 1 1 1 0 1 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 1 3 2 1 0 0 2 1 0 0 0 2 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 2 0 0 0 1 0 0 0 0 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 25 35 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 26 14 47
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 23 40 27
ND5 (size: 1761 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (3.92%)
Alanine (Ala, A)
n = 36 (6.14%)
Serine (Ser, S)
n = 50 (8.53%)
Threonine (Thr, T)
n = 66 (11.26%)
Cysteine (Cys, C)
n = 3 (0.51%)
Valine (Val, V)
n = 13 (2.22%)
Leucine (Leu, L)
n = 88 (15.02%)
Isoleucine (Ile, I)
n = 64 (10.92%)
Methionine (Met, M)
n = 48 (8.19%)
Proline (Pro, P)
n = 26 (4.44%)
Phenylalanine (Phe, F)
n = 32 (5.46%)
Tyrosine (Tyr, Y)
n = 10 (1.71%)
Tryptophan (Trp, W)
n = 10 (1.71%)
Aspartic acid (Asp, D)
n = 8 (1.37%)
Glutamic acid (Glu, E)
n = 11 (1.88%)
Asparagine (Asn, N)
n = 34 (5.8%)
Glutamine (Gln, Q)
n = 17 (2.9%)
Histidine (His, H)
n = 15 (2.56%)
Lysine (Lys, K)
n = 24 (4.1%)
Arginine (Arg, R)
n = 8 (1.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
37 27 42 24 10 36 1 17 15 2 7 4 2 0 13 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 8 15 12 1 6 6 9 2 3 8 15 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 38 1 7 12 20 0 4 7 3 7 1 0 19 15 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 1 6 2 22 2 0 2 6 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 137 247 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 167 120 245
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 159 254 157
ND6 (size: 495 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (13.41%)
Alanine (Ala, A)
n = 5 (3.05%)
Serine (Ser, S)
n = 14 (8.54%)
Threonine (Thr, T)
n = 3 (1.83%)
Cysteine (Cys, C)
n = 6 (3.66%)
Valine (Val, V)
n = 30 (18.29%)
Leucine (Leu, L)
n = 26 (15.85%)
Isoleucine (Ile, I)
n = 6 (3.66%)
Methionine (Met, M)
n = 9 (5.49%)
Proline (Pro, P)
n = 2 (1.22%)
Phenylalanine (Phe, F)
n = 12 (7.32%)
Tyrosine (Tyr, Y)
n = 9 (5.49%)
Tryptophan (Trp, W)
n = 4 (2.44%)
Aspartic acid (Asp, D)
n = 2 (1.22%)
Glutamic acid (Glu, E)
n = 4 (2.44%)
Asparagine (Asn, N)
n = 3 (1.83%)
Glutamine (Gln, Q)
n = 1 (0.61%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.83%)
Arginine (Arg, R)
n = 3 (1.83%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 5 3 0 0 1 15 0 1 14 3 8 5 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 6 0 1 2 2 0 11 2 0 9 2 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 6 1 0 0 6 1 9 0 2 7 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 2 2 0 1 2 3 0 0 0 1 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 10 32 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 17 22 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 12 37 83
Total protein-coding genes (size: 11247 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 190 (5.07%)
Alanine (Ala, A)
n = 235 (6.28%)
Serine (Ser, S)
n = 276 (7.37%)
Threonine (Thr, T)
n = 381 (10.18%)
Cysteine (Cys, C)
n = 30 (0.8%)
Valine (Val, V)
n = 162 (4.33%)
Leucine (Leu, L)
n = 585 (15.63%)
Isoleucine (Ile, I)
n = 334 (8.92%)
Methionine (Met, M)
n = 273 (7.29%)
Proline (Pro, P)
n = 194 (5.18%)
Phenylalanine (Phe, F)
n = 208 (5.56%)
Tyrosine (Tyr, Y)
n = 109 (2.91%)
Tryptophan (Trp, W)
n = 98 (2.62%)
Aspartic acid (Asp, D)
n = 58 (1.55%)
Glutamic acid (Glu, E)
n = 94 (2.51%)
Asparagine (Asn, N)
n = 152 (4.06%)
Glutamine (Gln, Q)
n = 98 (2.62%)
Histidine (His, H)
n = 96 (2.56%)
Lysine (Lys, K)
n = 105 (2.8%)
Arginine (Arg, R)
n = 63 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
191 143 239 127 57 247 19 122 90 8 48 38 64 12 113 95
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
34 16 14 57 76 97 5 47 42 71 30 34 44 108 8 89
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
117 168 7 58 56 100 8 19 35 47 62 12 13 70 82 36
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
60 83 11 33 25 95 10 8 15 35 5 1 1 2 0 86
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
739 901 1301 804
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
437 1032 714 1562
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
183 961 1608 993

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.