Viewing data for Antilocapra americana


Scientific name Antilocapra americana
Common name Pronghorn
Maximum lifespan 15.50 years (Antilocapra americana@AnAge)

Total mtDNA (size: 16352 bases) GC AT G C A T
Base content (bases) 6552 9800 4374 2178 4276 5524
Base content per 1 kb (bases) 401 599 267 133 261 338
Base content (%) 40.1% 59.9%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4575 6763 3241 1334 2988 3775
Base content per 1 kb (bases) 404 596 286 118 264 333
Base content (%) 40.4% 59.6%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1512 bases) GC AT G C A T
Base content (bases) 570 942 326 244 417 525
Base content per 1 kb (bases) 377 623 216 161 276 347
Base content (%) 37.7% 62.3%
Total rRNA-coding genes (size: 2531 bases) GC AT G C A T
Base content (bases) 1014 1517 560 454 589 928
Base content per 1 kb (bases) 401 599 221 179 233 367
Base content (%) 40.1% 59.9%
12S rRNA gene (size: 958 bases) GC AT G C A T
Base content (bases) 397 561 218 179 219 342
Base content per 1 kb (bases) 414 586 228 187 229 357
Base content (%) 41.4% 58.6%
16S rRNA gene (size: 1573 bases) GC AT G C A T
Base content (bases) 617 956 342 275 370 586
Base content per 1 kb (bases) 392 608 217 175 235 373
Base content (%) 39.2% 60.8%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 271 410 195 76 189 221
Base content per 1 kb (bases) 398 602 286 112 278 325
Base content (%) 39.8% 60.2%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 66 141 51 15 56 85
Base content per 1 kb (bases) 319 681 246 72 271 411
Base content (%) 31.9% 68.1%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 647 898 399 248 441 457
Base content per 1 kb (bases) 419 581 258 161 285 296
Base content (%) 41.9% 58.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 269 415 172 97 171 244
Base content per 1 kb (bases) 393 607 251 142 250 357
Base content (%) 39.3% 60.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 354 430 237 117 211 219
Base content per 1 kb (bases) 452 548 302 149 269 279
Base content (%) 45.2% 54.8%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 488 652 341 147 280 372
Base content per 1 kb (bases) 428 572 299 129 246 326
Base content (%) 42.8% 57.2%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 405 551 290 115 248 303
Base content per 1 kb (bases) 424 576 303 120 259 317
Base content (%) 42.4% 57.6%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 378 664 294 84 271 393
Base content per 1 kb (bases) 363 637 282 81 260 377
Base content (%) 36.3% 63.7%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 148 198 111 37 88 110
Base content per 1 kb (bases) 428 572 321 107 254 318
Base content (%) 42.8% 57.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 535 843 393 142 381 462
Base content per 1 kb (bases) 388 612 285 103 276 335
Base content (%) 38.8% 61.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 119 178 82 37 87 91
Base content per 1 kb (bases) 401 599 276 125 293 306
Base content (%) 40.1% 59.9%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 724 1097 537 187 479 618
Base content per 1 kb (bases) 398 602 295 103 263 339
Base content (%) 39.8% 60.2%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 193 335 154 39 110 225
Base content per 1 kb (bases) 366 634 292 74 208 426
Base content (%) 36.6% 63.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 9 8 4 6 23 3 7 8 1 2 3 2 1 9 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 9 4 1 3 2 6 0 1 4 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 15 2 2 2 6 0 1 4 0 2 1 0 6 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 4 0 0 2 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 68 84 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 63 38 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 64 99 50
ATP8 (size: 207 bases)
Amino acid sequence: MPQLDTSTWFTMIVSMFLTLFIIFQLKIAKHTLYHNPESTLTKTQKQNTPWETKWTKIYLPLSLPQQF*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.47%)
Serine (Ser, S)
n = 4 (5.88%)
Threonine (Thr, T)
n = 11 (16.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.47%)
Leucine (Leu, L)
n = 9 (13.24%)
Isoleucine (Ile, I)
n = 5 (7.35%)
Methionine (Met, M)
n = 3 (4.41%)
Proline (Pro, P)
n = 5 (7.35%)
Phenylalanine (Phe, F)
n = 5 (7.35%)
Tyrosine (Tyr, Y)
n = 2 (2.94%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 1 (1.47%)
Glutamic acid (Glu, E)
n = 2 (2.94%)
Asparagine (Asn, N)
n = 2 (2.94%)
Glutamine (Gln, Q)
n = 6 (8.82%)
Histidine (His, H)
n = 2 (2.94%)
Lysine (Lys, K)
n = 6 (8.82%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 2 1 1 2 0 4 6 0 0 0 0 1 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 2 1 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 3 0 0 4 0 0 0 2 0 0 1 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 6 0 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 17 27 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 21 22 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 13 36 13
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 38 (7.39%)
Serine (Ser, S)
n = 32 (6.23%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 10 26 9 6 25 6 13 6 0 8 6 21 3 12 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 5 22 10 1 6 9 29 3 5 8 15 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 21 0 4 8 16 1 1 2 9 10 0 0 6 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 3 3 13 9 0 0 2 6 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 105 140 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 161 221 109
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 16 (7.05%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 7 11 4 2 17 2 7 4 2 5 1 7 1 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 1 2 5 0 0 4 3 1 2 1 10 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 11 2 4 1 11 0 1 4 3 7 0 1 3 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 15 1 1 9 5 0 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 58 66 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 56 61 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 58 117 38
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 6 9 5 5 14 1 6 7 0 0 6 8 2 8 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 1 10 4 0 2 11 5 2 1 5 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 0 3 2 9 1 1 3 5 6 0 0 1 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 2 1 2 1 1 1 2 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 67 62 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 102 103 44
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 19 (5.01%)
Leucine (Leu, L)
n = 55 (14.51%)
Isoleucine (Ile, I)
n = 40 (10.55%)
Methionine (Met, M)
n = 19 (5.01%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 28 17 0 13 34 3 5 5 1 2 7 10 0 5 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 2 4 19 0 1 6 15 2 1 4 18 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 15 0 5 4 9 1 0 3 3 11 0 0 0 18 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 0 11 8 1 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 99 114 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 91 76 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 151 182 37
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.1%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 20 (6.31%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 16 (5.05%)
Leucine (Leu, L)
n = 57 (17.98%)
Isoleucine (Ile, I)
n = 28 (8.83%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 18 (5.68%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 20 16 1 9 40 1 6 6 1 5 4 7 0 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 2 14 12 1 0 7 5 1 1 10 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 11 2 1 8 12 0 1 1 4 7 0 0 8 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 2 1 7 0 0 1 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 91 88 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 92 55 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 107 159 43
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 18 40 4 9 38 0 5 9 0 2 1 7 1 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 2 10 6 0 0 3 10 1 2 6 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 20 1 4 8 13 0 0 2 4 4 1 0 3 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 0 12 0 0 0 3 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 89 147 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 104 57 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 101 189 52
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 18 40 4 9 38 0 5 9 0 2 1 7 1 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 2 10 6 0 0 3 10 1 2 6 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 20 1 4 8 13 0 0 2 4 4 1 0 3 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 0 12 0 0 0 3 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 89 147 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 104 57 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 101 189 52
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 90 (19.65%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 20 (4.37%)
Tyrosine (Tyr, Y)
n = 18 (3.93%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 18 32 10 15 51 3 10 9 2 1 7 8 0 7 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 3 9 13 1 3 8 7 0 1 9 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 22 2 5 9 12 0 4 7 11 7 0 1 9 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 0 1 2 10 1 1 2 7 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 133 162 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 115 85 203
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 145 215 85
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 5 10 0 4 11 2 5 1 1 0 1 5 1 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 3 3 2 3 0 1 1 1 1 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 1 1 4 4 0 0 1 2 2 0 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 23 28 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 35 46 12
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 43 (7.1%)
Serine (Ser, S)
n = 47 (7.76%)
Threonine (Thr, T)
n = 51 (8.42%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 61 (10.07%)
Methionine (Met, M)
n = 45 (7.43%)
Proline (Pro, P)
n = 29 (4.79%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 17 (2.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 36 (5.94%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 41 43 6 15 54 1 13 17 1 4 2 7 0 11 36
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 5 5 20 18 0 4 9 12 3 5 12 11 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 25 2 8 11 14 2 2 10 7 10 0 0 9 27 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 1 3 9 21 2 1 4 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 142 228 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 158 129 255
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 237 261 94
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 5 (2.86%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 17 (9.71%)
Isoleucine (Ile, I)
n = 16 (9.14%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 0 5 2 0 0 1 6 0 1 11 1 3 9 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 4 0 0 1 13 0 6 7 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 3 3 2 1 1 4 0 8 2 3 8 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 4 0 1 3 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 8 48 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 25 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 6 29 92
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.68%)
Alanine (Ala, A)
n = 243 (6.39%)
Serine (Ser, S)
n = 275 (7.24%)
Threonine (Thr, T)
n = 319 (8.39%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 186 (4.89%)
Leucine (Leu, L)
n = 589 (15.5%)
Isoleucine (Ile, I)
n = 331 (8.71%)
Methionine (Met, M)
n = 260 (6.84%)
Proline (Pro, P)
n = 199 (5.24%)
Phenylalanine (Phe, F)
n = 243 (6.39%)
Tyrosine (Tyr, Y)
n = 129 (3.39%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 165 (4.34%)
Glutamine (Gln, Q)
n = 91 (2.39%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
165 166 224 48 93 325 24 88 81 10 41 39 87 19 83 160
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
36 7 19 30 111 97 5 33 61 101 21 26 62 110 1 47
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
87 167 18 41 59 115 6 15 39 58 71 5 11 54 111 16
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
77 82 15 16 52 87 8 4 15 44 1 1 0 6 1 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
810 937 1225 829
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
465 982 745 1609
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
181 1222 1714 684

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.